KEGG   Equus caballus (horse): 100057231Help
Entry
100057231         CDS       T01058                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100057231 (USP26)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100057231 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 917 aa AA seqDB search
MAPLIVHGFAQIWSGNIRMSKTKEAYIRTVEEKKKVILVVSFNTGEYTTFQLVNIKNVVF
RSYGENENQLNLIFQNDDFLFIEKLSLRDGKELKMFLESFRKNNELPMRPDRVGGVFASR
TIQKEINKTSFHKVCKKSSSGSYETGEGTGIPDLQKMPLFTSKLPTRTCEELLENRCEKG
KRKLSSASETNEDIPKQSNSIGNKKSKTSLLRYVSHNEKKKLRLKESRENKKCGFSLKSN
FTGNPYIDGTSLPRILYQKMYLAFLLEPKYSEDEPEWQKLKMSFEIYPEKVWEGLPNLGN
TCYMNAVLQSLFSIPSFADDLLNQGFPWSKIPLDVLSMCLAQLLVLKDIYNIKIKEKLLM
SIKKIISAVAKIFSGNIQNDAHEFLGHCLDQMKENIGRINTIWKARSESEEENSPQQVFA
SSAATEVLVCPVVTNFEFELLRSIICKACGRVVLRTEVNNYLSVNLPQGPKAVPLSIQST
FDLFFGVEELEYKCEKCKHRRSVAVHKFSRLPRVLIIHLKRYSFNEFCSLRKDDQEIIIS
KYLKLSSHCNESTKPPLPLNKNAHIRDLQILKIFQKIHSEAISSLTASTKLTLESKSSLT
PHAGSGKESEPQKYQILNKGTSREQQQKDLGKYSKLNIIESKLLNSGHGTIIEKELLAAS
LMMGLEDTSFSLTHEGEGKSHSGPDTRVHPQEVLEHLKLKKYEKTRMFVDFESATETTKD
FSEDKKARIPEGYPKVAKQIQQCKRMRIYEQALRQALLESLPEPDAQWHTEKLRRPTEVT
LQEANVSSLGALGSNKNPGNKDVLDKEKTETKAKKPKRNAEIRDRHAYQLIGVVSHLGQT
PNSGHYISDAYDFERQVWFTYNDLLVSSIQEALMQEARLCTGYIFFYMHNEIFEELVGRE
EKFQSSNANAGETPQGE
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctaattgtacatggctttgcccaaatatggagtgggaatattaggatgtct
aagacgaaagaagcatacattcgaacagtggaagagaagaagaaagttattctggtggtc
tcttttaacactggagaatatacaacttttcagctagttaatattaaaaatgtggtcttt
agatcctatggagaaaacgaaaatcagctgaatttaattttccaaaatgatgacttctta
tttattgaaaaattatccttgagagatggtaaagagttgaagatgttcctggagagtttc
cgtaaaaataatgaactacccatgagacctgatagggttgggggtgtctttgctagcagg
acaatacagaaggaaattaacaaaacttcatttcacaaagtgtgtaagaagtcaagtagt
ggatcttatgagacaggagaaggaactggaatacctgacctccagaagatgcctttgttt
acatcaaaattaccaacacgtacctgcgaagagttattagaaaatcgatgtgagaaaggg
aaaaggaaactatcgtctgcttcagagacgaatgaggacatcccaaaacagagtaactcc
atcggaaacaagaaatccaagacaagtctcttgaggtatgtaagccacaatgagaagaaa
aaattgaggttaaaagagtcgcgagagaataagaaatgtggattttcactcaagagcaat
ttcactggaaacccctacatagatggcactagtcttccccgaattctgtatcagaaaatg
tatttggcatttcttttggaaccaaagtatagtgaggatgagccagagtggcagaaactc
aagatgagcttcgaaatttacccagaaaaagtatgggaaggccttcccaatttgggaaac
acctgttacatgaatgcagttttacagtccctattttcgattccatcatttgctgatgat
ttactcaatcagggtttcccatggagtaaaattccccttgatgttcttagcatgtgcttg
gcacagctgcttgttttgaaagatatttataacataaaaatcaaggagaagttacttatg
agtattaaaaagatcatttcagcagttgcaaagatattctctggcaacatacagaatgat
gctcatgagtttttaggtcactgtttagatcagatgaaagagaacataggaagaataaac
actatttggaaggctagaagtgaatctgaggaagaaaactcacctcaacaggtttttgct
agcagtgctgccaccgaagtgctcgtttgtcctgtcgtcacgaattttgagttcgagttg
ctgcgctctattatttgtaaagcctgtggtagagttgttctcaggacagaagtgaataat
tatctctctgtcaaccttccccagggaccaaaagcagttcctttatctattcaatctact
tttgatcttttctttggagtggaagagcttgagtataaatgtgagaagtgtaagcacagg
aggtctgttgcagtgcacaaattcagtaggctacccagggtccttattattcatctgaaa
cgctatagctttaatgagttttgctcattaaggaaggatgaccaggaaatcattatttcc
aaatatttgaaattgtcttctcattgcaatgaaagtaccaaaccacctcttcccttgaac
aagaatgcacatattagggatctccaaatcttaaaaatctttcaaaagatacattctgaa
gccatcagttcattgacagcttcaacgaagttgacgttggaatccaagtcttccctgact
ccacatgctggatcaggcaaagagtctgaaccacaaaaataccaaattctcaataaagga
acaagcagagaacagcagcaaaaagacctgggaaaatattctaaactgaatataatagag
tccaaattgttaaactcggggcatggaacaatcattgaaaaagagctgttagcagctagc
ttaatgatgggtctggaagacacctccttttctctgacccatgaaggggaaggcaaatct
cacagtggtccagatacacgtgttcatcctcaggaagtgcttgaacatcttaaactaaag
aaatatgagaaaacccgtatgtttgtagattttgagagtgccaccgagactactaaagat
ttttctgaagataaaaaagccagaattccagaaggatacccaaaagtggctaaacagatc
cagcagtgtaaaaggatgagaatctatgaacaagcccttcggcaggcactgcttgaaagc
cttccagagccagatgcccagtggcacacggagaagcttagaagacctacagaagtaact
ctccaggaggccaatgtgagttccctaggtgcattgggttccaataaaaaccctggaaac
aaagacgttttagataaggagaagacagaaaccaaagccaagaaaccaaaaagaaatgcc
gagatcagagacagacatgcctatcaactcattggtgtggtcagccatctcgggcagacc
ccaaattcaggccattatatcagcgatgcctatgactttgagagacaagtctggttcact
tacaatgatctgctggtatcaagtatccaagaggctctgatgcaggaggctaggctttgc
acagggtacatcttcttttacatgcacaatgagatctttgaagagctggtgggaagggaa
gagaagttccagtctagtaacgcaaatgcaggggagacccctcagggggaataa

DBGET integrated database retrieval system