KEGG   Equus caballus (horse): 100057364Help
Entry
100057364         CDS       T01058                                 

Gene name
CLTC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
ecb  Equus caballus (horse)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100057364 (CLTC)
   04142 Lysosome
    100057364 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100057364 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100057364 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100057364 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100057364 (CLTC)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100057364 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtata
aacccagcaaacattggcttcagtaccctgactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagctagtaaagtaatt
gcactgaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttaaatacggttgct
cttgttacggataatgcagtgtaccattggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgccattctagccttgcaggatgtcagattatcaattatcgtacagatgca
aagcaaaagtggttacttctgactggtatatctgcacagcaaaatcgtgtggttggagct
atgcagttatattctgtagataggaaagtgtctcagcccattgaaggacatgcggccagc
ttcgcacagtttaagatggaaggaaatgcagaagaatcaacgttattttgttttgcagta
cggggtcaagctggagggaagttacatatcattgaagttggcacaccacctacagggaac
cagccttttccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtagtattcctgattactaagtatggt
tatatccacctctatgatctggagactggtacttgcatctacatgaacagaatcagtgga
gaaacaatctttgttactgcacctcacgaagccacagctggaatcattggagtaaacaga
aagggacaagttctatcagtatgtgtggaagaagaaaacataattccttatatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtacgtaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtggctgctaatgcaccaaagggaatccttcgtaccccagacaccatccgtcgg
ttccagagtgtcccagctcagccaggtcaaacttctcctctacttcagtactttggaatt
cttttggaccagggccagctaaacaaatatgaatccttagaattatgtaggcctgtactt
cagcaagggcggaaacagcttttggagaaatggttaaaagaagataagctggaatgttct
gaagaactgggtgaccttgtgaaatctgtggaccctacgttggcacttagtgtgtactta
agagctaatgtcccaaataaagtcattcagtgctttgcagaaacaggtcaagtgcagaag
attgttttatatgctaaaaaagttggatatactccagactggatctttctgctgagaaat
gtcatgcgtatcagtccagatcaaggacagcagtttgctcaaatgttagttcaggatgaa
gaacctcttgctgatatcacacagattgtcgatgtctttatggagtacaatttaattcag
cagtgtactgcattcttgcttgatgccctgaagaataatcgcccatctgaaggtccctta
cagacgcggttgcttgagatgaaccttatgcatgcacctcaagttgcagatgctattcta
gggaatcagatgttcacgcattatgaccgggctcatatcgcgcagctgtgtgagaaggct
ggcctactgcagcgtgcattagaacacttcactgatttatatgatataaagcgtgcggtt
gttcatacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagta
gaagactccctagaatgcctcagggccatgctgtctgccaatattcgtcagaatctgcag
atttgtgttcaggtggcttctaagtatcacgaacaactatcaactcagtctctgattgaa
ctttttgaatctttcaagagttttgaaggtcttttttattttctgggatccattgttaac
tttagtcaggacccagatgtgcactttaaatatattcaggcagcttgtaagactgggcag
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaag
aattttctcaaggaagcgaagctaacagatcagttaccactcatcattgtgtgtgatcga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacagaaggtgaatccaagtcgacttcctgtggttattggagggttactt
gatgttgattgctctgaagatgtcattaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgtggctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaatgcgttagcc
aaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttattat
gacagtcgtgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccaatgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttcccgctatctggtacgcagaaaggatccagaattgtggggtagtgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggtcgtgcagacagccttgtct
gagactcaggaccctgaagaagtgtcagtaactgtcaaggcttttatgactgcagacctt
ccaaatgaactcattgaactgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatttgcaaaacctcctcatcctcactgcaattaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatatcgccaatattgccatc
agcaatgagctgtttgaagaagcatttgctattttccggaaatttgatgtcaatacttca
gcagtgcaggtcttgattgaacatattggaaacttggatcgagcatatgagtttgctgaa
cgctgcaatgaacctgcagtctggagtcagcttgcgaaagcccagttgcagaaaggaatg
gttaaagaagccattgattcttatatcaaagcagatgatccttcatcctacatggaagtt
gttcaggctgccaatactagcggaaactgggaagaactggtgaaatacttgcagatggcc
cgtaagaaggctcgagagtcctatgtggagacagaattaatatttgcactggctaaaaca
aaccgccttgcagaattagaagaattcatcaatggacctaataatgctcatatccaacaa
gttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttattgtacaataat
gtttccaattttggacgcttggcatctaccctggttcacctgggcgagtatcaggcagct
gttgatggagctaggaaagctaacagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagttccgtctcgctcagatgtgtgggcttcatattgtagtacatgca
gatgaattggaggaacttatcaactactatcaggatcgtggatattttgaagaactgata
accatgttggaagcagcattgggacttgagcgagctcatatggggatgtttaccgaatta
gctattctgtattctaaatttaagccacagaaaatgagggagcacctggagctgttctgg
tctagagtgaatattcctaaggtgctgagagctgcagaacaagctcatctttgggcagaa
ctggtgtttttgtatgacaagtatgaagaatatgataatgccataattaccatgatgaat
catccaactgatgcctggaaagaaggacagttcaaagatatcattaccaaggttgccaat
gtggaactatactacagagcaatacagttctacttagaattcaagcctctgttgttgaat
gatttgctgatggttctttctccacggttggatcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttgcgttcagttcagaaccacaacaac
aaatctgtgaacgaatcactgaacaacctctttattacagaagaagattatcaggctctg
cgaacgtcaatagatgcttatgacaactttgacaatatctcacttgctcagcgtttggaa
aaacatgaactcattgagtttagaagaattgctgcttacctcttcaaaggcaacaatcgc
tggaaacagagtgtagagctatgcaagaaagatagcctgtacaaggatgcaatgcagtat
gcctctgaatctaaagatactgagttggctgaagagctcctacagtggtttttgcaagaa
gaaaaaagagagtgctttggagcttgtctctttacctgttatgatcttttaaggccagat
gttgtcctggaaactgcctggaggcacaatatcatggattttgccatgccctattttatc
caggtcatgaaggaatacttaacaaaggtggataaattagatgcttcagaatcactgaga
aaagaagaagaacaagctacagagacacaacctattgtttatggtcagccccagttgatg
ctgacggcaggacccagtgttgcagtccctccccaggcaccttttggctatggttatact
gcaccaccctatgggcagccacagcctggctttgggtacagcatgtga

DBGET integrated database retrieval system