KEGG   Equus caballus (horse): 100057478Help
Entry
100057478         CDS       T01058                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1 precursor
  KO
K16857  thrombospondin 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04115  p53 signaling pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05144  Malaria
ecb05165  Human papillomavirus infection
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100057478 (THBS1)
   04350 TGF-beta signaling pathway
    100057478 (THBS1)
   04151 PI3K-Akt signaling pathway
    100057478 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100057478 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100057478 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100057478 (THBS1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100057478 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100057478 (THBS1)
   05205 Proteoglycans in cancer
    100057478 (THBS1)
   05219 Bladder cancer
    100057478 (THBS1)
  Infectious diseases
   05165 Human papillomavirus infection
    100057478 (THBS1)
   05144 Malaria
    100057478 (THBS1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100057478 (THBS1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100057478 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 cEGF EGF_CA Laminin_G_3 Laminin_G_2 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 100057478
NCBI-ProteinID: NP_001295881
Ensembl: ENSECAG00000008923
UniProt: F6YR34
Position
1
AA seq 1170 aa AA seqDB search
MGLAWGLSVLFLLHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQIFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLNNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSNMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACRKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGTKCTSYPDGSWKCGACPPGYSGNGVQCEDVDECKEVPDACF
NHNGEHRCRNTDPGYNCLPCPPRFTGSQPFGQGVEHAAANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDVDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctgttcctcttacatgtgtgtggctccaaccgc
attccagagtctgggggagacaacagcgtgttcgacatctttgaactcacgggggctgcc
cgcaagggctctggacgccggctggtgaagggtcctgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctagtggat
gctgtgcgggccgagaaagggttcctcctcctggcctccctgaggcagatgaagaagacc
cggggcactctgctggccgtggagaggaaagaccactctggccagatcttcagtgtggtc
tccaatggcaaggcgggcaccctggacctgagcctgaccgtgcaggggaagcagcatgtg
gtgtccgtggaagaagcgctcctggcgaccggccagtggaagagcatcaccctgtttgtg
caggaggacagggcccagctttacatcgactgtgagaagatggagaatgctgagctggac
gtccccatccagagcatcttcaccagggacctggccagcatcgccagactccgcatcgca
aaaggaggtgtcaatgacaatttccagggggtgctgcagaacgtgaggtttgtcttcgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccaatgtcctcctc
accctcaacaacaatgtggtgaatggttccagccctgctatccgcactaactacatcggc
cacaagacgaaggatctgcaggccatctgtggcatctcttgtgatgagctgtccaacatg
gtcctggagctcaggggcctgcgtaccatcgtgaccacgcttcaggacagcatccgcaaa
gtgactgaagagaacaaagaactggccaatgagctgcggaggcctcccctctgctaccac
aacggagttcagtacaggaataatgaggaatggactgttgatagctgcactgagtgtcgc
tgccagaactcagtcactatctgcaaaaaagtttcctgccccatcatgccctgctccaat
gccacagttcctgatggagaatgctgcccccggtgttggcccagtgactctgcggacgat
ggctggtccccatggtctgagtggacttcctgctctgtgacatgtggcaatggaatccag
cagcgtggccgctcctgcgatagcctcaacaaccgatgcgagggctcctctgtccagacg
cggacctgccacattcaggagtgtgataagagatttaaacaggatggcggctggagccac
tggtccccatggtcatcttgctctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaatgggaaaccctgcgaaggcgaagctcgggag
accaaggcctgcaggaaggatgcctgccccatcaatggaggctggggtccctggtccccg
tgggacatctgttctgtcacctgtggaggaggggtgcagaaacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtgacagagaaccagatc
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccttgctttgctggtact
aagtgtactagctaccctgacgggagctggaaatgtggcgcctgtccccccggttacagc
ggaaatggcgtccagtgcgaagatgttgatgagtgcaaagaagtgcctgatgcctgcttc
aaccacaatggcgagcaccggtgtaggaacacagatcccggctacaactgcctgccctgc
ccgccgcgcttcactggctcgcagccctttggccagggcgtggagcatgccgctgccaac
aaacaggtgtgcaagccccgcaacccctgcacagacgggacacatgactgcaacaagaac
gccaagtgcaactacctgggccattacagcgaccccatgtaccgctgcgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggggaggacacggacctggacggctggcccaac
gaggacctggtgtgcgtggccaatgcaacttaccactgcaaaaaggataattgccccaac
cttcccaactcgggacaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gatgatgacaatgataaaattccagatgatagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccggatcaggctgacacggacaacaatggggaaggagacgcctgtgctgcagac
attgatggggatggtatcctcaatgagcgagacaactgccagtatgtctacaacgtggac
cagagggacacggatatggatggggttggagatcagtgtgataactgccccctggaacac
aatccagatcagctcgactctgattcagaccgcattggagatacctgtgacaacaatcag
gatattgacgaagatggccaccagaacaacctggacaactgtccctacgtgcccaatgcc
aaccaagctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaat
gacggcattcctgatgacagggacaactgcagacttgtgcccaatcccgaccagaaggac
tctgatggtgatggtcgaggtgatgcttgcaaagatgattttgaccacgacaatgtgcca
gatgttgatgacatttgtcctgaaaacgttgatatcagtgaaactgatttccgccgattc
cagatgattcctctagatcccaaagggacatctcaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggacttgctataggttat
gacgagtttaatgctgtggacttcagtgggaccttcttcatcaacaccgagagggatgat
gactacgccgggtttgtgtttggctaccagtccagcagccgcttctatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagagctcagggatactcaggc
ctttctgtgaaagttgtgaactccaccacagggcctggcgagcacctgcggaatgccctg
tggcacacaggaaacacccctggccaggtgcgtaccctgtggcatgaccctcgtcacata
ggctggaaagatttcactgcctacagatggcgtctcagccacaggccaaagacaggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgac
aaaacctatgctggcggcaggctagggttgtttgtcttctctcaagaaatggtgttcttc
tcagacctgaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system