KEGG   Equus caballus (horse): 100057484Help
Entry
100057484         CDS       T01058                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ecb04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:ecb05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ecb05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 1086 aa AA seqDB search
MAGNHRLGPEAGDTDDPPRITQNPVINGNVAMSDGHNTTEEDMEDDTSWRSEATFQFTVE
RFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQA
VLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQ
ADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSV
PLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCV
EGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGD
NKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEF
LQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEH
NYGGHDDDLSVRHCTNAYMLVYIRESRLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRK
ERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQNLSQTMGFP
QDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATL
PKFDKDHDVMLFLKMYDPKTRSLNYCGHVYTPISCKIRDLLPVMCDRAGFLQDTSLILYE
EVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDV
TFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHN
YEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHG
CVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIP
LDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFE
KFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEK
AIKIHN
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaccacaggctgggaccagaagctggagatacagatgacccaccaagaatt
actcagaaccctgttatcaacgggaatgtggccatgagtgatggacacaacaccaccgag
gaagacatggaggatgacacgagttggcgctccgaggcaacctttcagttcactgtcgag
cgcttcagcagactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgcca
tggaagattatggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtagga
ttctttctccagtgcaatgctgaatctgattccacgtcgtggtcttgtcacgcacaggca
gtgctgaagatcataaactacagggacgacgagaagtccttcagtcgtcgcattagtcac
ctgttcttccataaagagaacgactggggattctccaattttatggcctggagtgaagtg
actgatcctgagaaaggatttatagatgatgacaaagttacttttgaagtcttcgtccag
gccgatgctccccatggagttgcgtgggactcgaagaagcacacgggctatgtcggttta
aagaatcagggagcaacttgttacatgaacagcctgctgcagactttatttttcacaaat
cagctacgaaaggctgtgtacatgatgccgaccgagggcgatgactcgtctaaaagcgtc
cctttagcgttacagagggtcttctatgagctgcagcacagcgataagcccgtagggaca
aaaaagctcaccaagtccttcgggtgggaaactttagatagcttcatgcaacatgatgtt
caagagctgtgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacgtgtgta
gaaggcaccatacctaaattattcagaggcaaaatggtgtcctatatccagtgtaaggaa
gtagactatcggtctgatagaagagaagactattatgatatccagctaagtataaaagga
aagaaaaacatatttgaatcatttgtggattacgtggcagtagaacaactcgatggtgac
aataagtatgatgccggcgagcacggcttgcaggaagcagagaaaggtgtgaaattccta
acgttgccaccagtgttacatctgcagctgatgaggttcatgtatgaccctcagacggac
caaaacatcaagatcaacgacaggtttgaattccctgaacagttaccgctcgatgaattt
ttgcaaaaaacagaccctaaggaccctgccaactacattctccacgcggtcctggttcac
agtggagacaaccacggcgggcactacgtggtgtatctcaaccccaaaggggacggcaag
tggtgtaagtttgacgacgacgtggtgtcgaggtgtacgaaggaggaggccatcgagcac
aactacgggggccacgacgacgacctgtccgtgcggcactgcaccaatgcctacatgctg
gtgtacatcagggagtcgcggctgagtgaggttttacaagctgtcaccgaccatgacatt
cctcagcagctggtggaacgattacaggaggagaagaggatcgaggcccagaagcggaag
gagcggcaggaagcccatctctacatgcaagtgcagatagtcgcagaggaccagttctgt
ggccaccaaggaaatgatatgtacgatgaagaaaaggtgaaatacactgtattcaaagta
ttgaaaaactcctcgctggctgagtttgtccagaacctctcgcagaccatgggatttcca
caagatcaaattcgattatggcccatgcaagccaggagcaatggaaccaaacgaccggcc
atgttagataacgaggcagacggcaataaaacgatgattgaactcagcgataatgaaaac
ccctggacgatattcctggaaacagttgacccggagctggccgccagcggagccacgcta
cccaagtttgataaagatcatgatgtgatgttgtttctgaagatgtacgatcccaaaaca
cggagcttgaattactgtgggcacgtctatacacccatatcctgtaaaatacgtgacttg
ctcccggttatgtgtgacagagcaggatttctccaagacactagccttatcctctatgag
gaagttaaaccgaatttaacagagagaattcaggactatgacgtgtctcttgataaagcc
ctcgatgaactaatggatggtgacattatagtgtttcagaaggatgaccccgaaaatgat
aacagtgagttgcccaccgcaaaagagtacttcagggacctctaccaccgcgtggacgtc
accttctgtgataaaaccatcccaaacgaccctggattcgtggtcacgctgtccaataga
atgaactattttcaggtggcgaagaccgtcgcacagaggctcaacaccgaccccatgttg
ctccagtttttcaaatctcaagggtatagggatggcccagggaaccctcttagacataat
tatgaaggtactttacgagatcttctccagttcttcaagcctagacaacctaagaaactt
tactatcagcagcttaagatgaaaatcacagactttgaaaacaggcggagtttcaagtgt
atatggttaaacagccaatttagggaagaggaaataacactatatccagacaagcacggg
tgtgtccgggacctgctagaagaatgtaaaaaggctgtagagctcggagagaaggcgtca
gggaaacttaggctgctagaaattgtaagctacaaaattattggtgtgcaccaagaagac
gaactgttagaatgtttatctcccgcgacaagtcgaacgtttcgaatagaggaaatacct
ctggaccaggtagacatagataaggagaacgagatgctggtcacagtggcgcatttccac
aaggaggtgtttgggacgtttggaatcccgtttttgctgaggatacaccagggcgagcat
ttccgagaagtaatgaagcggattcagagtctgctagacatccaggaaaaggagtttgaa
aagtttaaatttgccattgtgatgatgggccgacaccagtacataaatgaagatgagtat
gaagtaaacttgaaagatttcgagcctcagcctggaaacatgtctcaccctcggccttgg
ctcgggctcgaccacttcaacaaagcccccaagaggagtcgctacacctacctggaaaag
gccattaaaatccataactga

DBGET integrated database retrieval system