KEGG   Equus caballus (horse): 100057675Help
Entry
100057675         CDS       T01058                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X1
  KO
K12497  early growth response protein 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04625  C-type lectin receptor signaling pathway
ecb05161  Hepatitis B
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100057675 (EGR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100057675 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100057675 (EGR3)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100057675 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-met zf-BED zf-C2H2_6 Zf_RING zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 100057675
NCBI-ProteinID: XP_001492393
Ensembl: ENSECAG00000023741
UniProt: F7BXS2
Position
2
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSESVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctctggcagcagc
gaatcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaacccggaactctcttattcgggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggtatcttgggggtgcccccggcctcaggggcactc
agcactcagacctctacggctagcatggtgcagccgccacagggcgatgtggaggccatg
tatccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtgtccttc
cacgacccgcagggcaaccccgggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaatctcttccccatgattcctgactacaacctatatcatcacccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aacccgcctcctattacccccctggagaccatcaaggcattcaaagacaagcagatccac
cctggcttcggaagcctaccccagccgccgctcacgctcaagcccatccggccccgcaag
taccccaaccgacccagcaagaccccgctccacgagcggccccacgcgtgcccggcggag
ggctgcgaccgccgtttcagccgctcagacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgtcggatctgcatgcggagcttcagccgcagcgaccacctt
accactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccatctcaagcaaaaggag
aagaaggcggagaaggggggtgcgccctctgcgtcctcggcgccccctgtgtccttggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system