KEGG   Equus caballus (horse): 100057725Help
Entry
100057725         CDS       T01058                                 

Gene name
ACSS1
Definition
(RefSeq) acetyl-coenzyme A synthetase 2-like, mitochondrial isoform X1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00620  Pyruvate metabolism
ecb00640  Propanoate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100057725 (ACSS1)
   00620 Pyruvate metabolism
    100057725 (ACSS1)
   00640 Propanoate metabolism
    100057725 (ACSS1)
Enzymes [BR:ecb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100057725 (ACSS1)
Lipid biosynthesis proteins [BR:ecb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100057725 (ACSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 100057725
NCBI-ProteinID: XP_005604771
Ensembl: ENSECAG00000023870
UniProt: F6YZ17
Position
22
AA seq 687 aa AA seqDB search
MAARSVGRGVGRLLGSLHGRSGQPARPLRGGSVPRRAASGLWDSAPAAPAAQPGSYQALS
AQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSSGKIGWFLGGQLNVSVNCLDQHVQKS
PESVALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVCRGDRVAIYMPVSPVAVAAM
LACARIGAVHTVVFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKQC
PTVQCILVAHRTENKVHMGDLDIPLEQEMAKEDPVCAPESMGSEDMLFMLYTSGSTGMPK
GLVHTQAGYLLYAALTHRLVFDYRPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFES
TPVYPDAGRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVRKYDRSSLRTLGSVGEPINL
EAWEWLHKVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPGMAMRPFFGIIPVLMD
EKGNVVEGGDVSGALCLSQAWPGMARTIYGDHQRFLDNYFKAYPGYYFTGDGAYRTEGGY
YQITGRIDDVINISGHRLGTAEIEDAMANHPAVPETAVIGYPHDIKGEAAFAFIVLRDDA
GDSDVVVNELRSAVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITGGVQDLGDI
TTLEDPSVITEILSAYQKYKDKRAAAH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgcagcgtgggccgcggcgtcgggaggctgctgggcagcctgcacgggcgc
tcggggcagccggcacggccgctgcgcggggggagtgtcccgcgccgggcggcctccggg
ctgtgggacagcgcccctgccgccccagccgcgcagcccggctcctaccaggcgctgagc
gcgcaggccgcccgggagccggccgccttttgggggccgctggcgcgggacacgctcgtg
tgggacaccccctaccacacggtctgggactgcgacttcagtagcggcaagatcggctgg
ttcctgggaggccagttaaacgtgtctgtcaattgcctggaccagcatgttcagaagtcc
ccggagagcgtcgctttgatctgggagcgagacgagcctggaactgaagtgaggatcacc
tacagggaactgctggagaccacatgccgcctggccaacacactgaagaggcatggggtc
tgtcgaggggaccgtgtggccatttatatgcctgtgtctccagtggctgtggccgcaatg
ctggcctgtgccaggatcggagccgtccacacggttgtctttgctggcttcagtgcggag
tccttggctgggagaatcaatgatgccaagtgtaaggtggttatcaccttcaaccaagga
ctccggggaggacgagtggtggagctgaagaagatagtggacgaagctgtgaagcagtgc
ccaactgtccagtgcatcctggtggctcacaggacggaaaacaaggtccacatgggggat
ctggacatccccctcgagcaggaaatggccaaggaggaccctgtgtgtgccccagagagc
atgggcagtgaggacatgctcttcatgctgtacacctctgggagcaccgggatgcccaaa
ggactcgtccacacccaggcgggctacctgctgtatgccgccctgacgcacaggcttgtg
tttgattaccggccaggcgacatctttggctgtgtggctgacatcggttggatcacagga
cacagctacgtagtgtacgggcccctctgcaatggagcgaccagcgtcctttttgagagc
accccggtttaccctgatgctggtcggtattgggagacagtacagaggttaaaaatcaat
cagttctacggcgccccgacggcggtgcggctgctgctgaagtacggcgatgcctgggtg
cggaagtacgaccgctcctccctgcggaccctggggtcagtgggagagccaatcaacctc
gaggcctgggagtggctccacaaggtggtgggggacagcagatgtacgctggtggacacc
tggtggcagacagaaacaggtggcatctgcatagcgccgcggccctcagaagaaggggca
gaaatcctccccggtatggcaatgaggcccttttttggcatcatcccggttctcatggat
gagaaggggaatgtcgtggagggtggcgatgtctctggagctctgtgcctctcccaggcc
tggccgggcatggccaggaccatctatggagaccaccagagattcctggataactacttc
aaggcttatccaggctactactttactggagatggtgcttaccgaaccgagggcggctat
taccagatcacagggcggatagatgacgtcatcaacatcagcggccaccggctgggcact
gcagagatcgaggatgcgatggctaaccaccctgcagtgccagagactgctgtcattggc
tatccccatgacatcaaaggagaagctgcatttgcctttatcgtgttgagggacgatgca
ggtgactctgacgtggtggtgaatgagctccggtcagcagtggccaccaagattgccaaa
tacgccgtgcctgatgagatcctggtagtgaaacgtcttccaaaaactcggtctggaaaa
gtcatgcggaggctcctgaggaagataatcacgggcggagttcaggatctgggggacatc
accaccctggaggaccccagtgtcatcacagaaatactgagtgcctaccagaagtacaaa
gacaagagggctgctgctcattga

DBGET integrated database retrieval system