KEGG   Equus caballus (horse): 100057750Help
Entry
100057750         CDS       T01058                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
ecb  Equus caballus (horse)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ecb04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ecb04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSSAIALEL
LKQGANPNIQDASGTTPAHDAARTGFLDTLRVLVEHGADVNAPDGTGALPIHLAVREGHN
AVVSFLAAESDLHHRDARGLTPLELARGRGAQDLMDILQGHTVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctgagcggggccgcggctcgaggcgac
gtgcaggaggtgcgccgccttctgcaccgggagctggtgcaccccgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttgggagctccgccattgccctggagctc
ctgaagcaaggggccaaccccaacatccaggacgcctccggcaccactccggctcatgac
gcggctcgcactggattcctggacaccctgagggtgttggtggaacatggcgctgatgtc
aacgcacctgatggcacaggcgcgctccccatccatctggcggtgcgggagggccacaac
gctgtcgtcagcttcctggctgctgagtctgatctccatcacagggatgccagggggctc
acccccctggagctggctcggggaagaggggcgcaggatctcatggacatactgcagggg
cacacggtggcaccgctgtga

DBGET integrated database retrieval system