KEGG   Equus caballus (horse): 100057750Help
Entry
100057750         CDS       T01058                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
ecb  Equus caballus (horse)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100057750 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100057750 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSSAIALEL
LKQGANPNIQDASGTTPAHDAARTGFLDTLRVLVEHGADVNAPDGTGALPIHLAVREGHN
AVVSFLAAESDLHHRDARGLTPLELARGRGAQDLMDILQGHTVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctgagcggggccgcggctcgaggcgac
gtgcaggaggtgcgccgccttctgcaccgggagctggtgcaccccgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttgggagctccgccattgccctggagctc
ctgaagcaaggggccaaccccaacatccaggacgcctccggcaccactccggctcatgac
gcggctcgcactggattcctggacaccctgagggtgttggtggaacatggcgctgatgtc
aacgcacctgatggcacaggcgcgctccccatccatctggcggtgcgggagggccacaac
gctgtcgtcagcttcctggctgctgagtctgatctccatcacagggatgccagggggctc
acccccctggagctggctcggggaagaggggcgcaggatctcatggacatactgcagggg
cacacggtggcaccgctgtga

DBGET integrated database retrieval system