KEGG   Equus caballus (horse): 100057963Help
Entry
100057963         CDS       T01058                                 

Gene name
FLNB
Definition
(RefSeq) filamin B, beta
  KO
K04437  
filamin
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100057963 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100057963 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100057963 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100057963 (FLNB)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100057963 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    100057963 (FLNB)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100057963 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 2514 aa AA seqDB search
MTKPLPLSSDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGW
IQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDW
LGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTG
NMVKQPAKFTVDTISAGQGDLMVFVEDPEGNKEEAQVTPANDKNKTYSVEYLPKVTGLHK
VTVLFAGQHISKSPFEVNVDKAHGDASKVTAKGPGLEATGNIANKPTYFDIYTAGAGVGD
IGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPVQPGPHVIKVSFAGDTIPKSPFVVQVGE
ACSPNACRASGRGLQPKGIRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLD
GVYAFEYYPSTPGKYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSA
DFVVESVGSEVGSLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIK
DSPYMAFIHPATGDYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGE
GQPIDIQMKSRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVF
GPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFT
VKYVPPAAGRYTIKVLFASEEIPASPFRVKVDPSHDASKVKAEGPGLTKSGVENGKPTHF
TVYTKGAGKAPLNVQFSGPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGSMQVLVTYGGDP
IPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTKGAGGQGKLDVTILSPSRKV
MPCLVAPVAGRESSTAKFVPREEGLYAIDVTYDGHPVPGSPYAVEASLPPDPSKVKAHGP
GLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYF
VNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLQHGKVGEAGLLSVDCSEAGPGALDL
EAVSDSGAKAEVCIENNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPTRVKVEPAVDT
SRVKVFGPGIEGKDVFREATTDFMIDSRPLTQVGGDHIKAHIANPSGASTPCFITDNADG
TYQVEYTPFEKGLHVVEVAYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNV
FTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPG
SPFRVPVKDVVDPSKVKIAGPGLGSGVRARILQSFTVDSSKAGLAPLEVRVMGPRGLVEP
VNIVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLS
SYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRY
MIGVTYGGDEIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKV
TCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGE
VTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPS
GKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYG
PGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDY
SILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGR
DEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVY
GRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGV
YIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSD
MSAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPL
GEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSC
GVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASF
AIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHMIDVKFNGSHVVG
SPFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVK
MDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSI
LVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIG
VHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7545 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcctctgcctctctcctcagatagcaaagccatcgtggatgggaacctgaag
ctcatcttgggcctggtgtggacactgatcctccactactccatctccatgcccgtgtgg
gaggatgaaggggatgatgatgccaagaagcagacaccaaagcagaggctgctgggatgg
attcagaacaagatcccctacttgcccatcactaactttaaccagaactggcaagatggc
aaagccctgggagccctggtagacagctgtgctccaggtctgtgccctgactgggagtcc
tgggacccacgaaagcctgtggataatgcacgagaagccatgcaacaggcagatgactgg
ctgggtgtcccacaggtcatcactcctgaagaaattattcacccggatgtggatgagcac
tcggtgatgacttacctgtcccagttccccaaagccaagctcaagccaggggctcctctt
aaacccaaactcaaccccaagaaagccagggcctatggcagaggaattgagcccactgga
aacatggtgaagcagccggccaagttcaccgtggacaccatcagtgctgggcaaggagac
ctgatggtgtttgttgaggacccagaaggcaacaaagaagaggcacaagtgaccccagcc
aacgacaagaacaagacgtactctgtggagtacctgccgaaggtcactgggctgcacaaa
gtcacagtcctctttgcaggacagcacatatccaagagcccatttgaagtgaatgttgac
aaggcccatggagacgccagcaaagtcactgcgaaaggcccaggcttggaagctacaggg
aacatcgccaataagcccacctactttgacatctacacggcaggtgctggcgtgggtgac
attggtgttgaggtggaggatcctcaggggaagaacaccgtggagttgcttgtggaagac
aaaggaaaccaggtgtatcgatgtgtgtacaagccagtgcaacctggcccccacgtaatc
aaggtctccttcgctggggacaccattcccaagagtccctttgttgtgcaggttggggaa
gcctgcagtccaaacgcctgccgggccagtggccgaggcctgcagcccaaaggcatccgt
atccgggagactgcagacttcaaggttgacaccaaagctgccggaagtggggagctcggc
gtaaccgtgaagggtcctaagggtctggaggagctggtgaagcagaaaggctttctggat
ggagtctatgcatttgaatattaccccagcaccccggggaaatacagcatcgccatcacg
tgggggggacaccacattccaaagagcccttttgaagttcaagttggtcctgaagcaggc
atgcagaaagtccgcgcctggggccctggcctccatggcgggattgttgggcgctcagcg
gactttgtggtggagtccgttggctctgaagtggggtctctggggtttgccattgaaggc
ccctcccaggcgaagattgagtatgacgaccagaatgatggatcgtgtgatgtcaagtac
tggcccaaggagcccggtgaatatgctgttcacatcatgtgtgacgacgaggacatcaag
gacagtccatacatggctttcatccacccagccacgggagactacaacccggatctggtc
cgagcgtacgggccgggtttggagaaatctggctgtatagtcaacaacctggccgagttc
accgtggatcctaaggatgctggaaaagctcccttaaagatttttgctcaggacggggaa
ggccagcccatcgacatccagatgaagagccggatggatggcacatatgcctgctcatat
accccagttaaggccatcaagcacaccattgctgtggtctggggaggtgtgaacatccca
cacagcccttacagggtcaacatcgggcagggtagccatccacagaaggtcaaagtgttt
gggccaggcgtggagagaagtggactgaaggcgaatgagcctactcacttcacagtggac
tgtactgaggctggggaaggtgatgtcagcgttggcattaaatgtgatgcccgggtgtta
agtgaggatgaggaagacgtggattttgacattattcacaacgccaacgacacgtttaca
gtcaaatatgtgcctcctgctgctgggcgatatactatcaaagttctctttgcgtctgag
gaaatccccgccagccctttcagagtcaaagttgacccttcccacgacgccagcaaggtg
aaggcagagggcccggggctcaccaaatcaggtgtggaaaacgggaaaccaacccacttc
actgtctacaccaaaggggctgggaaagccccactcaacgtgcagttcagcggccccctt
cctggcgacgcagtgaaggatttggatatcattgataattacgactactcccacaccgtt
aaatacacacccacccagcagggcagcatgcaggttctggttacctatggtggtgatccc
atccctaaaagcccattcaccgtgggcgttgctgcgccactggatctgagcaagataaaa
atcaatggactggaaaacagagtcgaggttgggaaggatcaagaattcgccattgacaca
aagggggcagggggccaggggaagctggacgttacgatcctgagcccatcgaggaaggtc
atgccgtgtctggtggcgcccgtggcgggccgggagagcagcactgccaagttcgtccct
cgggaggaagggctctatgctatagacgtgacctacgatggacaccctgtgcccgggagc
ccctacgcagtggaggcctcgctgccacctgatccctccaaggtgaaggcccatggtcct
ggccttgaaggtggtctcgtgggcaagcctgccgagttcaccatcgacaccaaaggagct
gggactggaggtttgggcctaactgtggaaggtccatgcgaggccaaaattgagtgctct
gacaatggcgatgggacctgctctgtctcgtaccttcccacaaaacccggggagtacttc
gtgaacattctcttcgaagaagtccacatacctggttctcccttcaaagctgacattgaa
atgccattcgacccctctaaggttgtggcgtcgggaccaggtctccagcacgggaaagtg
ggcgaagccgggctgcttagtgttgactgttccgaagctggtcccggggccctggacctg
gaagccgtctccgactcgggagcgaaagccgaagtctgtattgagaacaacaaagacggc
acctatgcggtgacctacgtgcccctgaccgccggcatgtatacgctgaccatgaagtat
ggcggtgagctcgtgccacacttccccaccagggtcaaggtggagcctgctgtggacacc
agcagggtcaaagtctttgggccaggaatagaaggaaaagacgtgtttcgtgaagccacc
actgacttcatgatcgactcacggcccctgacgcaggtcgggggtgaccacatcaaggcc
cacattgccaacccctcaggggcctccaccccgtgcttcatcacagacaatgccgatgga
acctaccaggtggagtacacgccctttgagaaaggcctccatgtagtggaggtggcatac
gatgatgtgcccatcccaaatagtcccttcaaagtggctgtaactgaaggctgccagcca
tctcgagttcaagcccaaggacctggattgaaagaggcctttaccaacaaacccaatgtc
ttcactgtggttaccagaggggcaggaattggtgggcttggcataactgtggagggacca
tcagagtcgaagataaactgcagagacaacaaagatggcagctgcagtgctgagtacatt
ccctttgctccaggggattatgatgttaatatcacttatggaggagcccacatccctggc
agccccttcagggttcctgtgaaggatgtcgtggaccccagcaaggtcaagattgccggc
cctgggctgggctcaggcgtccgagcccgcatcttgcagtccttcacggtggacagcagc
aaggctggcctggccccactggaagtgagggtcatgggcccacgaggcctggtggagcca
gtgaacatagtggacaacggggatggcacacatacagtgacctacaccccatcccaggag
ggaccttacatggtctcagttaaatatgccgatgaagagatccctcgtagtccctttaag
gtcaaggtccttcccacatatgatgccagcaaagtgaccgccagtggccctggcctcagt
tcctatggcgtacccgccagtctgcctgtggagtttgcaatcgatgccagagatgccggg
gaaggcctgcttgctgttcagataacggaccaagagggaaaacccaaaagagccattgtc
catgacaataaagatggcacgtatgctgtcacctacatccctgacaagacgggacgctat
atgatcggggtcacttatgggggtgatgagatcccgttatctccctaccgcatccgggcc
acacagacgggtgatgccagcaagtgcctggccacaggtcctggaatcgcctccactgtg
aaaaccggtgaggaggtgggctttgtggttgatgccaagactgctgggaaggggaaagtg
acctgcacagttctgaccccagatggcactgaggctgaggctgatgtcattgagaacgaa
gatggtacctatgacattttctacacggccgccaagccaggcacctatgtaatctacgtg
cgctttggtggcgttgatattcccaacagccccttcacggtcatggccacggatggggaa
gtcacagccgtggaggaggcaccggtaaatgcatgtccccctggattcaggccctgggta
accgaagaggcctatgtcccagtgagtgacatgaacggcctggggtttaaacccttcgac
ttggtcattccatttgcagtccggaaaggagaaatcaccggagaggtccacatgccttct
gggaagacggccacacctgagatcgtggacaacaaggatggcacggtcactgtgagatat
gcccccactgaggtcggactccatgagatgcacatcaaatacatgggcagccacatccct
gagagcccgctgcagttctacgtgaactaccccaacagtgggagcgtttctgcatacggt
ccaggcctggtgtatggagtggccaacaaaactgccaccttcaccatcgtcacagaggat
gcaggagaaggtggcctggacttggctattgaggggccctcaaaggccgaaatcagctgc
attgacaacaaagatgggacatgtacggtgacctacctgcccactctgccaggcgactac
agcattctggtcaagtacaatgacaagcacatccctgggagccccttcacagccaagatc
acggacgacagccggcggtgctctcaggtgaagttgggctctgcagccgacttcctgctc
gacatcagcgagactgacctcagcaccctgacagccagcattaaggccccatccggccgc
gacgagccctgtctcctgaagaggctgcccaacaatcacatcggcatctccttcatcccc
cgggaggtaggcgaacacctggtcagcatcaagaagaacggcaaccacgtggccaacagc
cccgtgtccatcatggtggtccagtctgagattggtgatgctcgcagagccaaagtctat
gggcgtggcctgtcagaaggccggacttttgagatgtctgacttcatcgtggacacaagg
gatgcaggttacggcggcatatccttggcggtggaaggccccagcaaggtggacatccag
acggaggatctggaagatggcacctgcaaggtttcctacttccccactgtgcctggggtt
tacattgtctctaccaaattcgctgatgagcatgtgccagggagcccgtttaccgtgaag
atcagtggggaggggagagtcaaggagagcatcacccggaccagtcgggccccgtctgtg
gccactgtcgggagcatctgcgacctgaacctgaaaatcccagaaatcgacagcagtgac
atgtcagcccacgtcaccagcccctctggccgcgtgaccgaggccgagattgtgcccgtg
gggaagaactctcactgtgtccggttcgtgccccaggagatgggggttcacacagtcagc
gtcaagtaccgtggccagcacgtaaccggcagccccttccagttcactgtggggccgctc
ggcgaggggggtgcccacaaggtccgggcaggaggccccggcctggagagaggagaagca
ggagtcccagctgagttcagtatctggacccgggaagcaggcgccgggggcctctccatc
gctgttgagggccccagtaaggccgagattacattcgatgaccataaaaatggatcatgc
ggtgtgtcttacattgcccaggagcctggtaactacgaggtgtctatcaagttcaacgat
gagcacatccctgaaagtccctacctggtacccgtcatcgcgccctccgacgatgcccgc
cgcctcactgttatgagccttcaggaatcgggattaaaagttaaccagccagcctccttt
gctataaggttgaatggggcaaaaggcaagattgatgcaaaggtgcacagcccctcggga
gccgtggaggagtgccacgtgtctgagctggagccagataaatatgccgttcgcttcatc
ccccacgagaatggcgtccacatgatcgacgtcaagttcaacgggagccacgtggttgga
agccctttcaaagtgcgcgtcggggagccaggacaagcggggaaccccgccctggtgtcc
gcctatggcgcaggacttgaggggggcaccacaggtatccagtctgaatttttcatcaac
accacccgagcagggccagggacattatctgtcaccattgaaggcccctccaaggttaaa
atggattgccaggaaaccccagaagggtacaaagtcatgtacacccccatggcccctgga
aactacctgattggcgtcaaatatggtgggcctaaccacatcgtgggcagtcctttcaag
gccaaggtgacaggccagcgtctggtcagccccggctcggccaatgagacctcatccatc
ctggtggagtcggtgaccaggtcctcgacagagacctgctatagtgccatccccaaggca
tcctcggacgccagcaaggtgacctccaagggggcagggctctcgaaggccttcgtgggc
cagaagagctccttcctggtggactgcagcaaagccggttccaacatgctgctgatcggg
gtccacgggcccaccaccccctgtgaagaggtctccatgaagcatgtgggcaaccagcag
tacaacgtcacgtacgtcgtcaaggagagaggggattacgttctggccgtgaagtgggga
gaggaacacatccccggcagccccttccacgtgacagtgccttaa

DBGET integrated database retrieval system