KEGG   Equus caballus (horse): 100058033Help
Entry
100058033         CDS       T01058                                 

Definition
(RefSeq) histo-blood group ABO system transferase 1-like
  KO
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
ecb  Equus caballus (horse)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100058033
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100058033
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100058033
Glycosyltransferases [BR:ecb01003]
 Glycan extension
  ABO blood group
   100058033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MVGECAELTRLSPSSCEAHHLQGQRESPPLRYVVFLKLFLETAEKYFMVGHRVIYYILTD
RPADVPQIPLQEGRRVVILKVRNYTRWQDVVLHRMEMISNFSQQRFLHEVDYLVSADVDM
KFSDHVGVEILSSLFGTLHPGFYASDRQRFTYERRPLSQAYIPEDEGDFYYAAALYGGSV
AEVYRLATACHQATLIDKANGIEAVWHEESHLNKYLLYHKPTKVLSPEYVWDERMLRKPP
YLRRLRYVAVPKNHAQIRSR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgaatgcgctgagctgacgcgactttctcccagcagctgtgaggcccaccac
ctgcagggccagcgggagagcccgccactgagatatgtggtcttcctgaagctgttcctg
gagacggcagagaagtacttcatggtgggtcacagggtcatctactacatcttaaccgac
cggccggcggacgtgccccagatccccctccaggaaggaaggcgagtggtgatcctcaag
gtccgaaactacacgcgctggcaggacgtggtcttgcaccgcatggagatgatcagcaac
ttctcccagcagcgcttcctccatgaggtcgattaccttgtgtccgcggacgtcgacatg
aagttcagcgaccacgtgggtgtggagatcctgtcgtctctctttggcaccctccatccc
ggtttctatgccagcgatcgccagcgtttcacctatgaacgccgcccattgtctcaggcc
tacattccggaagatgagggtgatttttactatgcagcagccttgtatggggggtcagtg
gcagaggtttaccggctcgccacagcctgtcaccaggcaacgctgatcgacaaggccaat
ggcatcgaggccgtgtggcacgaggagagccacctgaacaagtacctgctctaccacaag
cccaccaaggtgctgtccccagagtacgtgtgggatgagcggatgctgcggaaaccgcct
taccttaggagactgcgatacgtggctgtccccaagaatcatgcacaaattcggagcaga
tga

DBGET integrated database retrieval system