KEGG   Equus caballus (horse): 100058050Help
Entry
100058050         CDS       T01058                                 

Gene name
AP2B1
Definition
(RefSeq) adaptor related protein complex 2 beta 1 subunit
  KO
K11825  
AP-2 complex subunit beta-1
Organism
ecb  Equus caballus (horse)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100058050 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100058050 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    100058050 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100058050 (AP2B1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    100058050 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMGGANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaaatatttcacaaccaataaaaaaggagaaatctttgaattaaaggct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgactgtggggaaggatgttagttctctctttccagatgtagtgaactgtatgcagact
gacaacctggagctaaagaagcttgtgtatctctacttgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgtgaagatcccaatcct
ctgattcgggccttggcagtcagaaccatggggtgcatccgggtggacaagattacagaa
tatctctgtgagcccctccgcaagtgcttgaaggatgaagacccctatgttcggaagaca
gcagcagtctgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcagggg
tttctggattctctgcgggatctcatagcagattcaaatccaatggggggggctaatgct
gtagcagcgttatctgaaatcagcgaatctcatccaaacagcaacttactcgatctgaac
ccacagaacattaataaattgctgacagccctaaatgagtgtaccgaatggggccagatt
ttcatcttggactgcctatctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgaacgggtaactccccggctatctcatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaaatttctagagttgttacccaaggactctgactactacaatatgctg
ctgaagaagttggcccctccgcttgtcactttgctgtctggggagccagaggtgcagtac
gttgccctgaggaacatcaacctaattgttcagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaaatacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatcccaagccaacattgctcaggttctggcagaactgaaggag
tatgccacagaggtggatgttgactttgttcgcaaagctgtgcgggccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgcttgatctcatccag
accaaagtaaattatgtggtccaagaggcgattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcattgccactctttgtgagaatttagactcactggat
gagccagatgcacgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagttactagagagcttcctggagggttttcatgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctggtacagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgtcttctctcaacggaccctgtcacagccaaagaagta
gtcttgtctgagaagccactgatctctgaggagacggatcttattgagccaactctgctg
gatgagcttatctgccacattggttctttggcttctgtgtaccataagcctcccaatgct
tttgtggaaggaagtcatggaatccatcgcaaacacttgcccatacatcatgggagcact
gatgcaggtgacagccctgttggcaccaccactgccaccaacctggaacagcctcaggtt
atcccctctcaaggtgaccttctgggggaccttttaaaccttgaccttggtcccccagtc
aatgtgccacaggtatcctccatgcaaatgggagcagtggatctcttgggaggaggactg
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacag
tccttcatcccatcatcagtgcctgcaacctttgctccttcacctactcctgctgtggtc
agcagtggcctgaatgacctgtttgaactctccacagggataggcatggcacctggtgga
tatgtggctcccaaggctgtctggctgcctgcagtaaaggctaaaggcttggagatttct
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacagactttgcaatccagttcaacaagaatagctttggtgtcatcccc
agcactcctctggccatacatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaacacgttgggcccagtcatgaagatggaacctctgaataacctgcaggtggct
gtgaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtccttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacgtggaaggatattcccaat
gaaaatgaacttcagtttcagattaaggaatgtcatttaaatgccgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatctctgaagctcaccaacggcatttggattttggctgagttacgtatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagctcctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactag

DBGET integrated database retrieval system