KEGG   Equus caballus (horse): 100058160Help
Entry
100058160         CDS       T01058                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ecb  Equus caballus (horse)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Insulin resistance
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100058160 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100058160 (PPP1CC)
   04024 cAMP signaling pathway
    100058160 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    100058160 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100058160 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    100058160 (PPP1CC)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100058160 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100058160 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    100058160 (PPP1CC)
   04921 Oxytocin signaling pathway
    100058160 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100058160 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100058160 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    100058160 (PPP1CC)
   04720 Long-term potentiation
    100058160 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100058160 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100058160 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    100058160 (PPP1CC)
   05034 Alcoholism
    100058160 (PPP1CC)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100058160 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    100058160 (PPP1CC)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100058160 (PPP1CC)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100058160 (PPP1CC)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100058160 (PPP1CC)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100058160 (PPP1CC)
Spliceosome [BR:ecb03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100058160 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 366 aa AA seqDB search
MAAAQQRELGPVLETEKTEESVEDYTSWLRSRSVIGLKKQLKRSLKKVRGSKPGKNVQLQ
ENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLG
DYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKT
FTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK
DVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN
YCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRVTSGLNSTIQKASNYRN
NTVLYE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgctcagcagagagaattaggaccggtgctggagacagaaaagacggaggag
agcgtggaggactatacaagctggttgagaagccgctcggtaataggactaaaaaagcag
ctcaagaggagtcttaagaaagtgagggggtccaagcctggtaagaatgtccagctccag
gagaatgaaatcagaggactgtgcttaaagtctcgagagatctttctcagtcagcctatc
ctactagaactggaagcgccactcaaaatatgtggtgatatccatgggcaatactatgat
ttgcttcgactttttgagtacggtggtttcccaccagagagcaactacctgtttcttggg
gactatgtggacagggggaagcagtcgttggagactatctgcctcttactggcttacaaa
atcaaatatcctgagaatttttttcttctcagaggaaaccatgaatgtgccagcatcaat
agaatttatggattttatgatgaatgtaaaagaagatataacattaaactatggaaaact
ttcacagactgctttaactgtttaccgatagcagccatcgtagatgagaaaatattctgc
tgtcatggaggtttatcaccagatcttcaatctatggagcagattcggcgaattatgcga
ccaactgatgtaccagatcaaggtcttctttgtgatcttttgtggtctgaccccgataaa
gatgtcttaggctggggtgaaaatgacagaggagtgtccttcacatttggtgcagaagtg
gttgcaaaatttctccataagcatgatttggatcttatatgtagagcccatcaggtggtt
gaagatggatacgaattttttgcaaagaggcaattggtcactctgttttctgcacccaat
tattgtggcgagtttgacaatgcaggtgccatgatgagtgtggacgaaacgctaatgtgt
tcttttcagattttaaagcctgcggagaaaaagaagccaaatgccacgagacctgtaaca
cctccaagggttacatcaggcctgaactcgaccattcagaaagcttcaaattatagaaac
aatactgttctatacgagtga

DBGET integrated database retrieval system