KEGG   Equus caballus (horse): 100058232Help
Entry
100058232         CDS       T01058                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1036 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMMGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTTVQVPAFLQELVERDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKVTVKGNDGFWVGKSSLR
SWRQLALEQLDEQDGDADQSNGKMNGSTLNKDESKEERKEEEEELNFNEDILCPHGELCI
SENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPARCSPVSAVGNHALLCPHG
GLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRTEVGDANPSEAQYISEPK
LCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKP
DGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcctaccgcatctggctggagccgtgcatc
cgcggcgtgtgcagacgaaactgcaaaggaaatccgaattgcttggttgggattggtgag
catatttggttaggagaaatagatgaaaatagttttcataacatcgatgatcccaactgt
gagaggaggaaaaagaactcatttgtgggcctcacgaaccttggagctacttgttacgtc
aacacatttcttcaagtgtggtttctcaacttggagcttcggcaggcgctatacttatgt
ccaagtacctgtagcgactacatgatgggagatggcatccaagaagagaaagattatgag
cctcaaacaatttgtgagcatctccagtacttgtttgcattgttgcaaaacagtaacagg
cgatacattgatccgtcgggctttgttaaagccttgggcttggacacggggcagcagcag
gatgcccaagaattttcaaagctctttatgtctcttttggaagatactttgtctaaacaa
aagaatccagatgttcgtaacattgtccagcagcagttctgtggggaatatgcttatgta
actgtttgcaatcagtgtggcagagagtctaagcttttatcaaagttttatgaactggag
ttaaatatccaaggccacaaacagttaacggattgtatctcggaatttttgaaggaggaa
aaattagaaggagacaatcgatacttctgtgaaaactgtcaaagcaaacagaacgcgaca
aggaagattcgcctcctcagcctcccctgcaccctgaacttacagctgatgcgctttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcagaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctatgtgtatgagctcagtgca
gttctcatacacagaggagtgagtgcttattctggccactacattgcccatgtgaaagat
ccacagtccggtgaatggtataagtttaatgacgaagacatagaaaagatggaggggaag
aaattacaactagggattgaggaagatctagcagagccttctaagtcccagactcgtaaa
cccaagtgtggcaaaggaacccactgctcccgaaatgcatacatgttggtttatagactg
cagactcaagaaaaacccaacacaactgtgcaggtaccagcctttcttcaagagttggtg
gagcgggataattccaagtttgaggagtggtgtattgaaatggccgagatgcgtaagcaa
agcgtggacaaaggaaaagcaaagcacgaagaggtcaaggagctgtaccaaaggttacct
gctggagctgagccctatgaatttgtctctcttgagtggctgcagaagtggttggatgaa
tcgacgcccaccaagcctatcgataatcacgcttgcctgtgttcccatgacaagcttcat
cctgataaaatatcgatcatgaagagaatctctgagtatgcggctgacattttctacagt
cgatatggaggaggaccaagactaactgtgaaagccctgtgtaaggaatgtgtggtagaa
cgttgtcgtgtgttgcgtctgaagaaccaactaaatgaagattataaaactgttaataat
ctgctaaaagtaacagtaaagggcaatgatggattttgggtgggaaaatcctccttgcgc
agctggcgccagctagctctggaacaattagatgagcaagatggtgacgcagaccaaagc
aatgggaaaatgaacggcagcacgttgaataaagatgaatcaaaggaagaaagaaaagaa
gaagaagaggaattaaattttaatgaagatattctgtgtccacatggggagttatgcata
tctgaaaatgaaaggcggcttgtctctaaagaggcttggagcaaactgcagcagtacttt
ccaaaggctcccgagttcccaagttacaaagaatgctgttcgcagtgcaagattttagaa
agggaaggggaagaaaatgaagccttacataagatgatcgcaaacgagcaaaagacttct
cttccgaatttgttccaggacaaaaacagaccatgtctcagtaactggccagaggacacg
gatgtcctctacattgtgtcacagttttttgtagaagaatggcggaaatttgttagaaag
cctgcgcggtgcagccccgtgtcggcggtcgggaaccacgccctcctctgtccgcatggg
ggcctcatgttcacatttgcttccatgaccaaagaagattctaaacttatagctctcata
tggcccagtgagtggcagatgatacaaaagctctttgtagtggatcatgtaattaaaatc
acgagaactgaagtgggagatgcaaacccttcagaagcacaatatatttctgagcctaaa
ctttgtccagaatgcagagaaggcttattgtgtcagcaacagagggacctgcgtgaatac
actcaagccaccatctatgtccataaagttgtggataataaaaaggtgatgaaggattcg
gctccggagctgaatgtgagcagttccgaaacagaggaggataaggaagaagctaaacca
gatggagaaaaagatccagattttaatcaaagcaatggaggaacaaagcggcaaaagata
tcccatcagaattatatagcctatcaaaagcaagttattcggcggagtatgcgacataga
aaagttcgtggtgagaaagcacttcttgtttctgctaatcaaacgttaaaagaattgaaa
attcagatcatgcatgcattttcagttgctccttttgaccagaatctgtcaattgatgga
aagattttaagtgatgactgtgccaccctcggcacccttggcgtcattcctgaatctgtc
attttgttaaaggctgatgaaccaattgcagattatgctgcaatggatgatgtcatgcaa
gtgtgtatgccagaagaagggtttaaaggtactggtctacttggacattaa

DBGET integrated database retrieval system