KEGG   Equus caballus (horse): 100058275Help
Entry
100058275         CDS       T01058                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100058275 (ALPL)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100058275 (ALPL)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100058275 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 577 aa AA seqDB search
MVLEAGKAKMRVAASSVPGLEHQLTADYCQSLLFHPHQSYLWAPERKQVLERTMISPFLV
LAIGTCLTNSLVPEKEKDPKYWRAQAQQTLQNALRLQKLNTNVAKNIIMFLGDGMGVSTV
TAARILKGQLHNSPGEESRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGT
VGVSAATQRTQCNTTQGNEVTSILHWAKEAGKSVGIVTTTRVNHATPSAAYAHSADRDWY
SDNEMPSEALSQGCKDIAYQLVHNIKDIEVIMGGGRKYMFPKNRTDVEYEMDEKARGTRL
DGLNLIDIWKSFKPRHKHSHYIWNRTELLTLDPYTVDYLLGLFEPGDMQYELNRNNVTDP
SLSEMVEMAIKILSKNPEGFFLLVEGGRIDHGHHEGKAKQALHEVVEMDRAIGQAGDMTS
QEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPGYKVVGGE
RENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHVMAYA
ACIGANRDHCASASLAGSPSPGPLLLLLALLPLGILF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggttctggaagctgggaaggccaagatgagggtagcagccagttcagttcctggattg
gaacatcagttaacggctgactactgccagtcactcctctttcacccacatcaatcatac
ctctgggctccagagagaaagcaggtcttggagcgcaccatgatttcacccttcttagtg
ctggccattggcacctgccttaccaactccttagtgccagagaaagagaaagatcccaag
tactggagagctcaagctcagcagaccctacaaaatgccctgagacttcagaagctcaac
accaacgtggccaagaatatcatcatgttcctgggagatgggatgggcgtctccacggtg
acggccgcccgcatcctcaagggccagctccacaacagccctggggaggagagcaggctg
gagatggacaagttccccttcgtggccctctccaagacatacaacaccaacgctcaggtc
cctgacagcgcaggcaccgccactgcctacttgtgtggggtgaaggctaatgagggcact
gttggggtgagcgcagcgacccagcgcacccagtgcaacacgactcaggggaacgaggtc
acctccatcctgcactgggccaaggaggctgggaaatccgtgggcattgtgaccaccacg
cgagtgaaccacgccacccccagcgccgcctacgcccactctgccgaccgggactggtac
tcggacaacgagatgccctcggaggctctgagccagggctgcaaggacattgcctaccag
ctcgtgcacaacatcaaggacatcgaggtgatcatggggggcggccggaagtacatgttc
cccaagaatagaaccgacgtggagtatgagatggacgagaaggccaggggcacgagactg
gatggcctgaacctcatcgacatctggaagagcttcaaacccaggcacaagcactctcac
tacatctggaaccggaccgaactcctgaccctggacccctacaccgtggattacctcttg
ggtctctttgagccgggggacatgcagtacgagctgaacaggaacaacgtgaccgacccc
tcgctctccgagatggtggagatggccatcaagatcctgagcaagaaccccgaaggcttc
ttcctgctggtggaaggaggcaggattgaccacgggcaccacgagggcaaggccaagcag
gcactgcatgaggtggtggagatggaccgggcaatcgggcaggcgggcgacatgacctcc
caggaagacacgctgaccgtcgtcactgctgaccactcccacgtcttcacctttggcggg
tacactccccgtggcaactccatctttggtctggcccccatggtgagcgacacggacaag
aagcccttcactgccatcctgtatggcaacgggcctggctacaaggtggtgggcggtgag
cgagagaatgtctccatggtggactatgctcacaacaactaccaggcgcagtccgccgtg
cccctgcgccacgagacccacggtggggaggacgtcgccgtcttcgccaagggccccatg
gcgcacctgctgcacggcgtccacgagcagaactacatcccccacgtgatggcttacgca
gcctgcattggtgccaaccgagaccactgcgcctctgccagcttggcgggcagcccctcc
ccaggccccctgctgctcctgctggccctgctccccctgggcatcctgttctga

DBGET integrated database retrieval system