KEGG   Equus caballus (horse): 100058582Help
Entry
100058582         CDS       T01058                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100058582
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100058582
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100058582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6
AA seq 148 aa AA seqDB search
MRSTLIISLLSCFFAVYEAKVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTR
AFNGKNANGSSDYGLFQLNNKWWCKDNKRSSSNACNIMCSKLLDENIDDDISCAKRVVRD
PKGMSAWKAWVKHCKDKDLSEYLASCNL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccactctcatcatctccctcctcagctgcttctttgcagtttacgaggccaaa
gtcttctccaagtgtgagctggcccacaagctaaaggcccaggaaatggatggtttcggt
ggctacagcctggcaaactgggtctgcatggctgagtatgagagtaacttcaacacccgg
gcctttaatggaaaaaatgccaatggcagtagtgactatgggctcttccagctgaacaac
aagtggtggtgcaaagataacaagcgttcttcatcaaatgcctgcaacataatgtgcagc
aaacttttggatgagaacatcgatgatgacatcagctgtgccaagagggttgtgagagat
cctaaagggatgtctgcctggaaggcctgggtaaaacactgcaaggacaaggatttgtcc
gaatacctggctagctgtaacctgtga

DBGET integrated database retrieval system