KEGG   Equus caballus (horse): 100058665Help
Entry
100058665         CDS       T01058                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100058665 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100058665 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100058665 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100058665 (PLCD4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100058665 (PLCD4)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100058665 (PLCD4)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100058665 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100058665 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 788 aa AA seqDB search
MAFLLQGRLPVNQDLLLMQKGMSMRKVRSKNWKKLRYFRLQDDGMTVWHARQAGGSAKPS
FSISDVETVREGHESELLRSLAEEFPLEQGFTVVFHGRRSNLDLVANSVDEARIWMQGLQ
LLVDFVTSMDQQEWQDQWLSDWFQRGDKNQDGRMTFQEVQRLLRLMNVEMDQEYAFQLFQ
VSLLGKDVQKPAKATFSFGQNYSDPTQQHSFVESLPWDLAQCQAQWEVQEIFEXFSADGQ
KLTLLELWISSEEEQKEGDHASDLALELIDRYEPSESGKLWHVLSMDGFLSYLCSKDGDI
FNPTCRPIYQDMTQPLSHYYINSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWD
GPSGEPIVYHGHTLTSRILFKDVVATVAQYAFQTSDYPVILSLENHCSWEQQQIMVQHLT
EILGELLLRTTLDGLLPTQLPSPEELRRKVLVKGKKLRTLEEDLEEEEEEEELEPELEGE
QEDEPELEAQFESESQKLSPRSKDKKKEKKFKPSLCPSLSALVVYLKSVSFHSFTHSREH
YRFYEISSFSETKAKSLIKEAGNEFVQHNAWQLSRVYPSGLRTDSSNYNPQELWNAGCQM
VAMNVQTAGLEMDIHDGLFRQNGGCGYVLKPDFLRDAQSSFHPERPISPCKAQTLIIQVI
SGQQLPKVNKTKEGSIVDPLVRVEIFGIRPDTTYQETNYVENNGFNPYWGQTLCFRVLVP
ELALLRFVVKDYDWKSRHDFVGQYTLPWTCMKQGYRHIHLLSKDGTSLQPASIFVHICTR
EGLEGDES
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcctgctgcaaggccggctgcctgtcaatcaagacctcctgctgatgcagaaa
ggcatgtcgatgcgcaaggtgaggtccaaaaactggaagaaactgagatacttcaggctt
caggacgatggcatgacagtctggcatgcccgacaggctggaggcagtgccaagcccagc
ttctcaatctctgacgtggagacagtgcgtgagggccatgagtctgagttactgcgcagc
ctggcagaggagttccccctggagcaaggcttcactgtcgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgacgaggcccggatctggatgcaggggctccag
ctgttggtggactttgtcaccagcatggaccaacaggagtggcaggaccaatggctgagt
gactggttccagcgtggagacaaaaaccaggatggtcggatgaccttccaagaagtccag
cggttactgcgcctgatgaatgtggaaatggaccaagaatatgccttccagcttttccag
gtgagtcttttggggaaggatgtgcagaagccagccaaggccacattctcatttggccag
aattactctgaccctacccagcaacactcatttgttgaatctctcccatgggacttagca
caatgccaggctcaatgggaagtgcaggaaatctttgaanacttttcagctgatgggcag
aagctgaccctgctggaattgtggatttcctccgaggaggagcagaaagaaggagaccat
gcttctgaccttgctctggaactcatcgaccgctatgagccttcagagagcggcaaactg
tggcacgtgctgagtatggacggcttcctcagctacctctgctcaaaggatggagacatc
ttcaacccgacctgccgccccatctaccaggatatgactcaacccctgagccactactac
atcaactcctctcacaacacctacctagtgggggatcagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcggggttgccgctgcgtggaggtggatatatgggat
ggacctagcggggaacctattgtttatcatggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccactgtagcacagtatgccttccagacatcagactatccagtcatc
ttgtccctggagaaccactgcagctgggagcagcagcagatcatggtacagcacctgacc
gagatcctgggggagctgctgctgagaaccaccttggatggactgctgcccactcagctg
ccctcacctgaggagcttcggaggaaggtcctggtgaaggggaagaaattaaggacactt
gaggaggatctggaggaagaggaagaggaggaagagctagagcctgaactggagggggag
caggaggatgagccggagctggaggcccagtttgagtctgagtcccagaagttgagccct
cgcagtaaagacaaaaagaaggagaagaaattcaagcccagcttgtgtccatctctctct
gccctggttgtgtacttgaagtctgtctcattccacagcttcactcattcgagggagcac
taccgcttctatgagatatcatctttttctgaaacgaaagccaagagcctcatcaaagag
gctggcaatgagtttgtgcaacacaacgcctggcagttaagccgtgtatatcccagtggc
ctgaggacagattcgtccaactacaacccccaggaactctggaatgcaggctgccagatg
gtggctatgaatgtgcagactgcggggcttgagatggacatccatgatgggctcttccgc
cagaatggtggctgtggctacgtgctgaagccagacttcctgcgtgatgcccagagttcc
ttccaccctgagaggcccatcagcccttgcaaagcccagaccctcataatccaggtgatc
agtggtcagcaactccccaaagtgaacaagaccaaagagggctccattgtggatccactg
gtgagagtggagatatttggcatccgcccagatacaacctaccaagagaccaactatgtg
gagaacaatggttttaatccatactgggggcagacactctgcttccgggtcctggtgcct
gaactggcactgctgcgttttgtggtgaaagattatgactggaaatcccgacatgacttt
gttggtcagtacaccctgccttggacttgcatgaaacaaggttaccgccacatacacctt
ctctccaaggatggcaccagcctccagccagcttccatctttgtgcacatctgcacccga
gaagggctggagggggatgaatcctga

DBGET integrated database retrieval system