KEGG   Equus caballus (horse): 100058666Help
Entry
100058666         CDS       T01058                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100058666 (DYRK2)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100058666 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 528 aa AA seqDB search
MNDHLHVGSHGHGQVQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPGVPERQLESIHRR
QGSSTSLKSMEGVGKAKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQG
MTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMV
RNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIK
KNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSC
YEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLAC
MIELLGMPSQKLLDTSKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPES
REWGNALKGCDDPLFLDFLKQCLEWDPGVRLTPGQALRHPWLRRRLPKPPTGEKTSVKRV
TEATGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcacctgcatgtcggcagccacggccacgggcaggtccaggttcagcagctg
ttcgaggataacagtaacaagcggacagtgctcacgacacaaccaaatgggcttacaaca
gtgggcaaaacgggattgccgggcgtgccggagcggcagctggagagcatccaccgaagg
caggggagctccacctccctgaagtctatggagggtgtggggaaggcaaaagccaccccc
atgactcccgagcaagcaatgaagcaatacatgcaaaaactaaccgcctttgaacaccac
gagattttcagctaccccgaaatatacttcttgggtccaaacgcaaagaagcgccagggc
atgacaggtgggcccaacaacggtggctatgacgatgaccaggggtcgtacgtgcaggtg
ccccacgaccatgtggcttacaggtacgaggtcctcaaggtcattggaaagggcagcttt
gggcaggtggtcaaggcctacgaccacaaggtccaccagcacgtggccctgaagatggtg
cgaaacgagaagcgcttccaccggcaggcggcggaggagatccggattctggagcacctg
cgcaagcaggacaaggacaacaccatgaacgtcatccacatgctggagaatttcaccttc
cgcaaccacatctgcatgacgtttgagctgctgagcatgaacctctacgagctcatcaag
aagaataaattccagggcttcagcctgcctttggtccgcaagtttgcccactcgattctg
cagtgcttggatgctttgcacaaaaacaggataatccactgtgaccttaagcccgagaac
attctgttaaagcagcaggggagaagcggcattaaagtgatcgattttggctccagttgt
tacgagcatcagcgtgtctacacgtacattcagtcccgtttttaccgggccccggaagtg
atccttggcgccaggtacggcatgcccatcgacatgtggagcctgggctgcatcttggca
gagctcctgaccggttaccccctcttgcctggggaagatgaaggggaccagctggcctgc
atgattgaactcttgggcatgccgtcccagaaactgctggatacatccaaacgagccaaa
aattttgtgagctccaagggttacccccgctactgcactgtcaccactctctctgacggc
tctgtggtcctcaacgggggccgttcccggagggggaagctgaggggcccgcccgagagc
agagagtgggggaatgcactgaagggctgcgatgacccccttttcctcgacttcttaaaa
cagtgtttagagtgggatcctggggttcgcctgacccccggccaggctttacggcacccc
tggctgaggaggcggctgccaaagccgccgacgggggagaagacgtcagtgaaaagggtg
accgaggccactggtgctatcacctccatttccaagttacctccaccttccagctcagcc
tccaaactgaggacgaatttggcacagatgacggatgccaatgggaatattcagcagagg
acagtgttgccaaaacttgttagctga

DBGET integrated database retrieval system