KEGG   Equus caballus (horse): 100058869Help
Entry
100058869         CDS       T01058                                 

Gene name
EHMT1
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100058869 (EHMT1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100058869 (EHMT1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100058869 (EHMT1)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100058869 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 1315 aa AA seqDB search
MDGGSNFAVPSPALVMAHLLIIVIPAVPAKGETQQDCCMTTELLGEEEPSMAADEGLTEK
QGGEARTAADGETNGPCEKSDAGSHLNAAKHTQENTKASPQEGTNKLTRIAENGISERDT
EVGKQNHVRADDFTQTSVVGSNGYFFSKPSLQEQPLRITSTLASSLPGHAAKTLPGGTGK
GRTPSAFPQAPATVPAKLGEGSKDTEDKKPGAPGPDVKVHRARKTMPKSILGLHAASKDP
REVREARDEEPKEDINKNISDFGRQQLLPPFPPLHQSLPQNQCYVATTKSQTACLPFVLA
AAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGDSALHVNGE
SLEMDSEEEDSEELDEDEDQGAEQAAVFPTEDSRTSKESVLAADHSQKLDGESEEEQESA
GTGEEEEDGDESDLSSESSIKKKFLKRKGKPDSPWVKPARKRRRRSKKKQGSGPGSEAYT
SSSGSTEQTVPGDSTGYMEVSLDSLDLRVKGTLPSQAEGLANGPDSVETDGLQEVPLCSC
RMETPKSREITTLANNQCMATESVDHELGRCTNSVVKHELMRPSSKAPLLVLCEDHRGRM
VKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEETSKAKEVTI
AKADTTSTVTLAPGQEKSAVAEGRADTTTGSTAGPLLSEDDQPQSTAPPVPEGFEHVGPA
GLVRPAPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGI
DPNFKMEHQNKRSPLHAAAEAGHVDICHMLIQAGANIDTCSEDQRTPLMEAAENNHLDAV
KYLLKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATE
YKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAARCDLHAVNIHGDSP
LHIAAREDRYACVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWNALQMSKALRDSAPDR
PVPLEKTVSRDIARGYERIPIPCVNAIDDEPCPSNYKYVSQNCVTSPMNIDRNITHLQYC
VCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLLFECNHACSCWRNCRNRVVQN
GLRARLQLYRTQNMGWGVRSLQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDG
EVYCIDARFYGNVSRFINHHCEPNLVPVRVFMSHQDLRFPRIAFFSTRLIEAGEQLGFDY
GERFWDIKGKLFSCRCGSPKCRHSSTALAQRQASAAQVAQENGLPDTSSSTADPL
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atggacgggggctccaatttcgctgtaccatcaccagcacttgtcatggcacaccttttg
attatagtcatcccagcagttccggccaagggggagactcagcaggattgctgcatgaca
actgagctgctgggagaagaagagccctctatggctgctgatgaaggcttgacagagaag
caggggggagaggcccgcacggctgcagacggcgaaaccaacgggccctgtgagaagagc
gatgccggcagccatctaaatgcggcaaagcacactcaggaaaatacaaaagccagccca
caggaaggtaccaacaaactaacccgaatagcagaaaatgggatttcagaaagagacact
gaagtggggaagcaaaaccatgtcagagctgacgacttcacacagacttctgtcgttgga
agcaatggatacttcttcagcaagccgtccctgcaggagcagcccttgcggattaccagc
actttggcctcttcacttcctggtcatgctgcaaaaacccttcctggagggaccggcaaa
gggaggactcctagtgcttttcctcaggcaccagccacagtgccagccaagctcggggaa
gggagcaaagacacagaggacaagaagcctggggcccctggccccgatgtcaaggttcac
agggcacggaagaccatgccgaaatccatcctgggcctgcatgcagccagtaaggatccc
agagaagttcgagaagctcgagatgaggagccaaaagaggacatcaacaaaaacatttct
gattttggacgacagcagcttttaccccccttcccgccccttcatcagtcgctacctcaa
aaccaatgctacgtggccaccacaaagtcacagacagcttgcttgccttttgttttagca
gctgcagtatctcggaagaaaaaacgaagaatgggaacctatagcctggttcctaagaaa
aagaccaaagtattaaaacagaggacggtgattgagatgtttaagagcataactcattcc
actgtgggttccaagggcgagaaggacctgggcgacagtgcccttcatgtgaacggggag
agcttggagatggactcggaggaggaagactcggaggaacttgatgaggacgaagatcag
ggagccgagcaggccgctgtgtttcccacggaggacagcaggacttccaaagagagtgtg
ttggcagctgaccactcccagaagttggatggcgagtccgaagaggagcaggagtcggcc
ggcaccggggaggaagaggaggatggagacgagtctgatctgagctctgagtccagcatc
aagaagaagttcctcaagaggaaggggaagcctgacagcccgtgggtcaagccggcgagg
aagaggcggcggaggagcaagaagaagcaaggcagtgggccaggttctgaagcatacacg
tcgtcatcaggaagcacagagcagacggtgccaggagacagtacggggtacatggaagtt
tctctggattccctggatctccgtgtcaaggggacactgccctcacaagcagaagggctg
gccaacgggcccgactcagtggagacggatggcctccaggaagtgcccctctgcagctgc
cggatggagaccccgaaaagccgagagatcaccacgctggccaacaaccagtgcatggcc
acggagagtgtcgaccacgaactgggcaggtgcacaaacagcgtggtcaagcatgagctg
atgcgcccgtccagcaaggcaccactcttggtactgtgtgaagaccaccggggccggatg
gtgaagcaccagtgctgtcccggctgcggctacttctgcacggcgggtaattttatggaa
tgtcagcctgagagcagcatctcacatcgtttccacaaagactgtgcctctcgagtcaat
aatgccagctattgtccccactgtggggaggagacctccaaggccaaagaggtgacgatc
gcgaaagcagacacgacctccaccgtgacgctggccccagggcaggagaagagcgccgtg
gcagagggcagagctgacaccaccacgggcagcactgctggaccactgctctcagaggat
gaccagccgcagagcacggctcccccggtgcctgagggcttcgagcacgtggggccagcc
gggctggtgaggccagcccctggcctttcccagggaccagggaaggagaccctggagagc
gccctcattgctctggactcggaaaaacccaagaagcttcgcttccacccgaagcagctg
tacttctccgccaggcaaggggagctgcagaaggtgctcctcatgctggttgatggcatc
gaccccaacttcaagatggagcaccagaacaagcgctccccactgcacgccgcggcagag
gccggccacgtggacatctgccacatgctgattcaggcgggagcaaatattgacacctgc
tcagaagaccagaggaccccactgatggaggcggcagaaaacaaccatttagacgcggtg
aagtacctcctcaaggcaggggccctcgtggatcctaaggatgcagagggctccacctgt
ttgcacctggctgccaagaaaggccactatgacgtggttcagtatctgctttcaaatgga
caaatggatgtcaactgtcaggatgatggcggctggacacccatgatttgggccaccgag
tataagcacgtggacctcgtgaagctgctgctgtccaagggctccgacatcaacatccgg
gacaacgaggagaacatctgcctgcactgggcagccttctcgggctgtgtggacatagct
gaaatcctgctggccgccaggtgtgacctccacgccgtgaacatccatggggactcgccc
ctgcacatcgctgccagggaggaccgctacgcctgcgttgtcctctttctttctcgggat
tcagatgtcaccttgaaaaacaaggagggagagacacctctgcagtgcgcaagtctcaac
tctcaggtgtggaacgctttgcagatgagcaaggcgctgcgagactccgccccagacagg
cccgtcccgctggagaagacagtgagcagagacattgctcgaggctatgagcgaatcccc
attccatgtgtcaacgccatcgacgacgagccgtgccccagcaactacaaatacgtgtct
cagaactgtgtgacgtccccgatgaacatcgacagaaacatcacccatttgcagtactgt
gtgtgcatagacgactgctcctccagcaactgcatgtgcggccagctcagcatgcgctgc
tggtacgataaggatggccggctgctgccggagttcaacatggccgagcctcccctgctc
ttcgagtgcaaccacgcctgctcctgctggaggaactgtcggaaccgcgtggtgcagaat
ggcctgcgggcaaggctgcagctctaccggacacagaacatgggctggggcgtgcggtcc
ctgcaagacatcccactgggcaccttcgtctgcgagtacgtcggggagctcatctctgac
tccgaagccgacgttcgggaagaagattcttaccttttcgatcttgacaacaaggacggg
gaggtgtactgcattgatgcacgcttctacgggaacgtcagccgcttcatcaaccaccac
tgcgagcccaacttggtgcccgtgcgagtgttcatgtcacaccaggacctgcgcttcccc
aggatcgccttcttcagcacccgcctaatcgaggctggggagcagttggggtttgactac
ggggagcgcttctgggacatcaaaggcaagctgttcagctgccggtgtggctcccccaag
tgccggcactccagcacagccctggcccagcggcaggccagcgctgcccaggtggcccag
gagaacggcctgcctgacaccagctcttccaccgctgatcctctatga

DBGET integrated database retrieval system