KEGG   Equus caballus (horse): 100058869Help
Entry
100058869         CDS       T01058                                 

Gene name
EHMT1
Definition
(RefSeq) histone-lysine N-methyltransferase EHMT1 isoform X1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00310  Lysine degradation
ecb04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100058869 (EHMT1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100058869 (EHMT1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100058869 (EHMT1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100058869 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 SET Pre-SET XRCC4
Motif
Other DBs
NCBI-GeneID: 100058869
NCBI-ProteinID: XP_023485278
Ensembl: ENSECAG00000018405
Position
25
AA seq 1270 aa AA seqDB search
MTTELLGEEEPSMAADEGLTEKQGGEARTAADGETNGPCEKSDAGSHLNAAKHTQENTKA
SPQEGTNKLTRIAENGISERDTEVGKQNHVRADDFTQTSVVGSNGYFFSKPSLQEQPLRI
TSTLASSLPGHAAKTLPGGTGKGRTPSAFPQAPATVPAKLGEGSKDTEDKKPGAPGPDVK
VHRARKTMPKSILGLHAASKDPREVREARDEEPKEDINKNISDFGRQQLLPPFPPLHQSL
PQNQCYVATTKSQTAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSK
GEKDLGDSALHVNGESLEMDSEEEDSEELDEDEDQGAEQAAVFPTEDSRTSKESVLAADH
AQKLDGESEEEQESAGTGEEEEDGDESDLSSESSIKKKFLKRKGKPDSPWVKPARKRRRR
SKKKQGSGPGSEAYTSSSGSTEQTVPGDSTGYMEVSLDSLDLRVKGTLPSQAEGLANGPD
SVETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKHELMRPSS
KAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYC
PHCGEETSKAKEVTIAKADTTSTVTLAPGQEKSAVAEGRADTTTGSTAGPLLSEDDQPQS
TAPPVPEGFEHVGPAGLVRPAPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSAR
QGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLIQAGANIDTCSEDQR
TPLMEAAENNHLDAVKYLLKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVN
CQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLA
ARCDLHAVNIHGDSPLHIAAREDRYACVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWN
ALQMSKALRDSAPDRPVPLEKTVSRDIARGYERIPIPCVNAIDDEPCPSNYKYVSQNCVT
SPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLLFECNH
ACSCWRNCRNRVVQNGLRARLQLYRTQNMGWGVRSLQDIPLGTFVCEYVGELISDSEADV
REEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMSHQDLRFPRIAFF
STRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSTALAQRQASAAQVAQENGLP
DTSSSTADPL
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgagctgctgggagaagaagagccctctatggctgctgatgaaggcttgaca
gagaagcaggggggagaggcccgcacggctgcagacggcgaaaccaacgggccctgtgag
aagagcgatgccggcagccatctaaatgcggcaaagcacactcaggaaaatacaaaagcc
agcccacaggaaggtaccaacaaactaacccgaatagcagaaaatgggatttcagaaaga
gacactgaagtggggaagcaaaaccatgtcagagctgacgacttcacacagacttctgtc
gttggaagcaatggatacttcttcagcaagccgtccctgcaggagcagcccttgcggatt
accagcactttggcctcttcacttcctggtcatgctgcaaaaacccttcctggagggacc
ggcaaagggaggactcctagtgcttttcctcaggcaccagccacagtgccagccaagctc
ggggaagggagcaaagacacagaggacaagaagcctggggcccctggccccgatgtcaag
gttcacagggcacggaagaccatgccgaaatccatcctgggcctgcatgcagccagtaag
gatcccagagaagttcgagaagctcgagatgaggagccaaaagaggacatcaacaaaaac
atttctgattttggacgacagcagcttttaccccccttcccgccccttcatcagtcgcta
cctcaaaaccaatgctacgtggccaccacaaagtcacagacagcagctgcagtatctcgg
aagaaaaaacgaagaatgggaacctatagcctggttcctaagaaaaagaccaaagtatta
aaacagaggacggtgattgagatgtttaagagcataactcattccactgtgggttccaag
ggcgagaaggacctgggcgacagtgcccttcatgtgaacggggagagcttggagatggac
tcggaggaggaagactcggaggaacttgatgaggacgaagatcagggagccgagcaggcc
gctgtgtttcccacggaggacagcaggacttccaaagagagtgtgttggcagctgaccac
gcccagaagttggatggcgagtccgaagaggagcaggagtcggccggcaccggggaggaa
gaggaggatggagacgagtctgatctgagctctgagtccagcatcaagaagaagttcctc
aagaggaaggggaagcctgacagcccgtgggtcaagccggcgaggaagaggcggcggagg
agcaagaagaagcaaggcagtgggccaggttctgaagcatacacgtcgtcatcaggaagc
acagagcagacggtgccaggagacagtacggggtacatggaagtttctctggattccctg
gatctccgtgtcaaggggacactgccctcacaagcagaagggctggccaacgggcccgac
tcagtggagacggatggcctccaggaagtgcccctctgcagctgccggatggagaccccg
aaaagccgagagatcaccacgctggccaacaaccagtgcatggccacggagagtgtcgac
cacgaactgggcaggtgcacaaacagcgtggtcaagcatgagctgatgcgcccgtccagc
aaggcaccactcttggtactgtgtgaagaccaccggggccggatggtgaagcaccagtgc
tgtcccggctgcggctacttctgcacggcgggtaattttatggaatgtcagcctgagagc
agcatctcacatcgtttccacaaagactgtgcctctcgagtcaataatgccagctattgt
ccccactgtggggaggagacctccaaggccaaagaggtgacgatcgcgaaagcagacacg
acctccaccgtgacgctggccccagggcaggagaagagcgccgtggcagagggcagagct
gacaccaccacgggcagcactgctggaccactgctctcagaggatgaccagccgcagagc
acggctcccccggtgcctgagggcttcgagcacgtggggccagccgggctggtgaggcca
gcccctggcctttcccagggaccagggaaggagaccctggagagcgccctcattgctctg
gactcggaaaaacccaagaagcttcgcttccacccgaagcagctgtacttctccgccagg
caaggggagctgcagaaggtgctcctcatgctggttgatggcatcgaccccaacttcaag
atggagcaccagaacaagcgctccccactgcacgccgcggcagaggccggccacgtggac
atctgccacatgctgattcaggcgggagcaaatattgacacctgctcagaagaccagagg
accccactgatggaggcggcagaaaacaaccatttagacgcggtgaagtacctcctcaag
gcaggggccctcgtggatcctaaggatgcagagggctccacctgtttgcacctggctgcc
aagaaaggccactatgacgtggttcagtatctgctttcaaatggacaaatggatgtcaac
tgtcaggatgatggcggctggacacccatgatttgggccaccgagtataagcacgtggac
ctcgtgaagctgctgctgtccaagggctccgacatcaacatccgggacaacgaggagaac
atctgcctgcactgggcagccttctcgggctgtgtggacatagctgaaatcctgctggcc
gccaggtgtgacctccacgccgtgaacatccatggggactcgcccctgcacatcgctgcc
agggaggaccgctacgcctgcgttgtcctctttctttctcgggattcagatgtcaccttg
aaaaacaaggagggagagacacctctgcagtgcgcaagtctcaactctcaggtgtggaac
gctttgcagatgagcaaggcgctgcgagactccgccccagacaggcccgtcccgctggag
aagacagtgagcagagacattgctcgaggctatgagcgaatccccattccatgtgtcaac
gccatcgacgacgagccgtgccccagcaactacaaatacgtgtctcagaactgtgtgacg
tccccgatgaacatcgacagaaacatcacccatttgcagtactgtgtgtgcatagacgac
tgctcctccagcaactgcatgtgcggccagctcagcatgcgctgctggtacgataaggat
ggccggctgctgccggagttcaacatggccgagcctcccctgctcttcgagtgcaaccac
gcctgctcctgctggaggaactgtcggaaccgcgtggtgcagaatggcctgcgggcaagg
ctgcagctctaccggacacagaacatgggctggggcgtgcggtccctgcaagacatccca
ctgggcaccttcgtctgcgagtacgtcggggagctcatctctgactccgaagccgacgtt
cgggaagaagattcttaccttttcgatcttgacaacaaggacggggaggtgtactgcatt
gatgcacgcttctacgggaacgtcagccgcttcatcaaccaccactgcgagcccaacctg
gtgcccgtgcgagtgttcatgtcacaccaggacctgcgcttccccaggatcgccttcttc
agcacccgcctaatcgaggctggggagcagttggggtttgactacggggagcgcttctgg
gacatcaaaggcaagctgttcagctgccggtgtggctcccccaagtgccggcactccagc
acagccctggcccagcggcaggccagcgctgcccaggtggcccaggagaacggcctgcct
gacaccagctcttccaccgctgatcctctatga

DBGET integrated database retrieval system