KEGG   Equus caballus (horse): 100058928Help
Entry
100058928         CDS       T01058                                 

Gene name
KMT2E, MLL5
Definition
lysine (K)-specific methyltransferase 2E
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100058928 (KMT2E)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100058928 (KMT2E)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100058928 (KMT2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1810 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQNIAK
CKKAFREGSRKSSRVKGSAPEIDPSSDGANFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRLALRLGNGNDKKEINKSDLNTNNLLFKPPVESYIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IEDGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESTEN
INSGYETRRKKGKKEKDISKEKDPQNQNITLDCEGTTNKMKSPETKQIKPSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDAQIVSDAEVLQEQAKEETASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDAESTVLALEPETEAALTAIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDSLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENTSGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPTVNGENKSPLLLNDSCSLPDLTTPLKKRRLYQLLDSAYSETSTPTPSPYATPTH
TDITPMDPSFATPPRIKSDDEACRNSYKPIYSPVTPVTPGTPGNSMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLSLGPFRNSNLTELSLQEIKTIGYSSPRSRTEVNRQCPGEKESA
DLQLGLEAVEQTALHKTTETPAHDRTDSNSQLESAHSGRGTVYSSWVKSPDRTGVNFSVN
SNLRDLTPSHQLEVGGGFRVSESKCLTQDDPRGIFMETPVFCASEDGLVSGFGRTVNDNL
IDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKAEHFPLVSVSPHASGSLSSSNGDGCG
SRTENGEQVESSASLPLPTPAAASNATSEEPSSNCPVKESSASEKSEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDGGGESPCVPCSPSHVPSSPSSHSNHIPQLQPKGPVPSFSE
LTEDPDSENPEPTTTNECPSPEISQNTCKSPSKMSKPGSPGPVIPVQPHGKILTKPDSHW
EATGIVSEAENGVHLKTELPQKQLLNNSQALSKNHPPQPLTRSSSEQLSQKLPSVPGKLP
CPPSPHTENPPKSSTPHTPVQHGYLSPKPPAQPLGSPYRPHHSQSPQVGAPQREPQRNFY
SAAQNLQTSTQQATSGALFPQAPSGQSAATFSQFTQQSLNSSAHPGSSQQPVPGHHVTPG
HFLPSQSPTIHHPAAAAVPPPPPPPPAPGPHLVPQPSSHQQHSGAHIVGPVHAVTPGSHM
HSQTAGHHLPPPPPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNPAPPPPPPPPPSTVLA
SGHHATSAQALHHPPHQGPPLFPSSAHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPL
PVAGPHLQPQGPNSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTF
QNNYHGSGWH
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccgttgggggttgatacagcagaaacgtcatacttggaaatggct
gcaggctcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcgcatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccggcttcccctcctcca
tcagttcttattagcaaaaatgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggacggaagttacggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagtgtt
tggcaacatattgactgcatgggcattgacaggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggagtttggataaagagagagcagtgctactacaacgccgaaaa
agggaaaatatgtcagatggtgatactagcgcaaccgagagtggtgatgaggttcctgtg
gaattatatactgcgtttcagcataccccaacatcgattactttaactgcttcaagagtt
tccaaggttaatgataaaagaaggaaaaaaagtggcgagaaagaacaaaacattgcaaaa
tgtaaaaaagcctttcgtgaaggttctaggaaatcatcaagagttaagggttcagctcca
gagattgatccttcatctgatggtgcaaattttggatgggagacaaaaatcaaagcatgg
atggatcgatatgaagaagcaaataataaccaatacagtgagggtgttcaaagggaggca
caaagactagctctgagattaggcaatggaaatgacaaaaaagagataaataaatcagat
ttgaataccaacaatttgctcttcaaacctcctgtagagagctatatacaaaaaaataag
aaaatcctgaaatctgcaaaagatctgcctcctgatgcacttatcattgaatacagaggg
aagtttatgctcagagaacagtttgaagcaaatgggtatttctttaagagaccataccct
tttgttttattctattctaaatttcacgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcggttcatccgacgttcttgtacacccaatgcagaggtgaggcatgaa
attgaagatggaaccatacatctttacatttattctatacaaagtattccaaagggaact
gaaattactattgcctttgattttgactatgggaattgtaagtacaaggtggattgtgca
tgcctcaaagaaaacccagagtgccctgtactaaaacgtagttctgaatccacggaaaac
atcaatagtggttatgagaccagaaggaaaaaaggaaaaaaagaaaaagatatttcaaag
gaaaaagacccacaaaatcagaatattactttagattgtgagggaacaaccaacaaaatg
aagagcccagaaactaaacagataaagccgtctccactgcgactgtcagtgtcaaataat
caggaaccagattttattgatgatattgaagaaaaaactcccattagcaatgaagttgaa
atggaatcagaggagcagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattctgcaagcttttgccagacttgaaaaaagagagaaaagaagagaacaa
gctttggaaaggatcagcacagccaaaactgaagttaaaacggaatgtaaagatgcccag
attgtcagtgatgctgaagttcttcaggaacaagcaaaagaagaaactgctagcaagcca
actcctgccaaagtgaatagaacaaaacagaggaaaagcttttctcggagtaggactcac
attggacagcagcgtcggcgccacagaactgtgagcatgtgttcggacatccagccatct
tctcctgacatagaagttacttcacaacaaaatgatgctgaaagtactgtgcttgcacta
gaaccagaaactgaagctgcactaacagcaataattactgagacggaagtcccagcactt
aataaatgtcctacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagacagcctttcagaaaggcctctgcgcata
actacagatccagaagtgttagccacacagctcaactctttaccaggtctcacttatagt
ccccatgtgtactctactccaaagcactatattagatttacttcaccattcctttcagaa
aaaaggagaagaaaagaacctaccgaaaatacttctggctcatgcaagaagcgatggctg
aaacaagctttagaagaagaaaactcagcaattttacatagatttaattcaccctgtcaa
gaaagatccagaagtcctacagtcaatggtgaaaataaaagtccactactattaaatgat
agctgttcccttccagatttaactacaccactaaaaaaacgaagactttatcagttgcta
gattctgcttactcagaaacctctacacctactccttcaccatatgctacaccaactcac
accgacattactccaatggacccgtcatttgctactcctccacgaataaaatcagatgat
gaagcttgcagaaatagttataagcccatatattcaccagttaccccagtaactcctggc
acaccaggaaatagcatgcactttgagaatatttcttccccagaaagttctccagaaatt
aagagacgcacttatagtcaagagggatatgacagatcttcaaccatgttatcattgggg
ccttttagaaattctaatttaactgaactgagtctgcaggaaatcaagacgattggttat
agcagccctaggagcaggactgaagtcaacaggcagtgccctggggagaaggagtctgca
gacctccaactgggactcgaggccgttgagcagactgccttacataaaaccacggagaca
cctgcgcatgacaggactgattccaacagccagctggaatcggctcactccggacggggc
acagtgtattcttcctgggtgaagagtcctgacaggacaggagttaacttctccgtaaac
tctaacctgagggacctgacaccctcacaccagttagaggtgggaggaggcttccgagtg
agtgagtcaaagtgcctgacacaggacgaccctagaggcatctttatggagacccctgtg
ttctgtgcttcagaagatgggctcgtatctggtttcggacggactgtcaatgacaacttg
attgacggaagctgcacaccccaaaatccaccacaaaagaaaaaggtgtctctgttagaa
taccgtaaaagacaacgtgaagctaggaaaagtggctctaaggcagaacacttcccattg
gttagcgtatcgcctcacgcaagcggaagcttgagcagcagcaatggtgatgggtgtggc
agcaggaccgaaaatggggagcaggtagagagctcagccagcctacctctaccaacacca
gctgctgcttctaacgctacttcggaggaacccagcagtaactgtcccgttaaggaaagt
tctgccagtgagaagagtgaaccggaagttcaatggactgcctcaacttccgtggagcaa
gtgagagagaggagttaccagagagctctacttctcagtgaccaccgcaaagacaaagac
ggtgggggagagtcaccctgtgtcccatgttcaccgagtcatgttccgtcttcaccttca
tctcattcaaatcacattccccagttgcaacccaagggcccagtcccttctttcagtgaa
ctcacggaagatcctgattctgaaaatccagaacccacgactacaaatgaatgtccatcc
ccagagatttctcagaatacttgtaaaagcccttcaaaaatgagcaagcctggttcgcca
ggacctgtcattcctgttcaaccacatgggaaaatactcacaaaaccagattcccattgg
gaggcaacaggtattgtgtcagaagctgagaatggtgttcacctgaaaacagaactccca
cagaaacagctattaaataacagccaggcactttccaagaatcaccccccgcagccgctc
acgcgcagttcgtctgagcaactttcccaaaagctgccttctgtgccggggaagctgccc
tgccctccatcacctcacacagaaaacccgcccaagtcgtcgacgccgcacacccccgtc
cagcatggctatctctcaccaaagcccccggcacagcccttaggatcgccctacaggccg
caccattcacagtcacctcaagtcggagcccctcagcgagagccacagagaaatttttat
tcagcggcacagaaccttcaaaccagtactcagcaggcaacatctggagcattatttcca
caggcaccctcaggacaatctgcagcaacattcagtcagtttacccaacagagtctgaac
agctcggcccaccccggctccagccagcagccagttccaggccaccacgtgactcccggg
cactttctgccttctcagagtcctactattcaccatcctgctgccgccgcggtcccaccc
ccacccccgccaccgcccgcgccagggccccacctcgtcccgcagcccagttcccatcag
caacactctggagcacacatagtggggcctgtccatgccgtcacccctgggtcgcacatg
cattcgcaaactgctggacaccacttgccaccaccccctccacctcctggtcctgcccct
caccaccatccaccgccccacccttccacaggactccagggtctacaagcacaacaccag
catgttgtaaacccagccccgccgccgccgccgccgccgcctccttccactgttctggct
tccgggcatcacgccacatcagctcaagccttacaccacccacctcatcaaggacctcca
cttttcccttcgagtgctcatccagctgtaccaccatatccctcacaagctacacatcac
accactttgggaccgggaccccaacaccagccttctggaacagggccacattgtccatta
ccagtcgcaggtccccatctccagccccaaggaccaaacagtattccaacacctactgct
tcagggttctgtcctcatcctggctctgtggccctgccacatggggtccaaggacctcag
caggcatctccagtgcctggacagattccaattcacagagcacaggtgccaccaacattt
cagaacaattaccatggttcagggtggcattaa

DBGET integrated database retrieval system