KEGG   Equus caballus (horse): 100058959Help
Entry
100058959         CDS       T01058                                 

Gene name
CPB1
Definition
(RefSeq) carboxypeptidase B
  KO
K01291  carboxypeptidase B [EC:3.4.17.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04972  Pancreatic secretion
ecb04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100058959 (CPB1)
   04974 Protein digestion and absorption
    100058959 (CPB1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     100058959 (CPB1)
Peptidases [BR:ecb01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100058959 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 Intimin_C
Motif
Other DBs
NCBI-GeneID: 100058959
NCBI-ProteinID: XP_001492094
Ensembl: ENSECAG00000021384
UniProt: F6XIJ7
Position
16
AA seq 417 aa AA seqDB search
MLAFLLLVTVTLASAHESGEHFEGEKVFRVKVEDKNHVNLLQELASTNQIDFWKPDSATQ
ITPHSTVDFHVKAEDILTVEDFLEQNELQYEVLIGNLRSALEAQFDSGARATGHSYEKYN
NWETIEAWTKQVASENPNLISRSTIGTTFEGRNIYLLKVGKAGSNKPAIFIDCGFHAREW
ISPAFCQWFVKEAVRTYGSESQMTQLLNTFDFYVVPVLNIDGYVYTWTTNRMWRKTRSVR
SGSTCVGTDPNRNFNAGWCSIGASRSPCADTYCGPAAESEKETKALADFIRKNLSSIKAY
LTIHSYSQMLLYPYSYAYKLPANNAELNTLAKATVNELASLYGTKYTYGPGASTIYPAAG
GSDDWAYDQGIKYSFTFELRDTGRYGFALPESQIRATCEETLRAVKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgttcttgcttctcgtgactgtgaccctagcctctgctcatgagtctggtgag
cactttgaaggtgagaaggtgttccgtgtcaaggttgaagacaaaaatcacgtcaactta
ctccaggagttggccagcaccaaccagattgacttctggaaaccagattctgccacacaa
atcacacctcacagtacagttgacttccacgttaaagcagaagatattttgaccgtggaa
gactttctggagcagaatgaactacaatatgaggtgctgataggcaacctgagatctgcg
ctggaggctcagtttgacagcggggcccgcgcaacgggacacagttacgagaagtacaac
aactgggaaacgatagaggcctggactaaacaagtcgccagcgagaatccaaacctcatc
tcccgcagtaccattggcaccacgtttgaaggacgcaatatatacctcctcaaggttggt
aaagctggatcaaacaagcctgccattttcatagactgtggtttccacgccagagagtgg
atttcccctgcattttgccaatggtttgtgaaagaggctgttcgcacctatggaagtgag
agccagatgacacaactcctcaacacgtttgacttttatgtcgtgcctgtgctcaatatt
gacggctacgtctacacctggaccacgaaccgaatgtggagaaaaacgcgctccgtccgc
agcggaagtacctgcgttggcacagaccccaacagaaatttcaacgctggttggtgctcc
attggagcatctcgaagcccgtgtgctgacacttactgcggacctgctgcagagtctgaa
aaggagaccaaagccctggctgatttcatccgcaaaaacctctcctccatcaaagcgtac
ctcacaatccactcctactcccagatgctgctctacccttactcttacgcttacaaactc
ccggcgaacaatgctgagttgaacaccctggccaaagccaccgtaaatgaactggccagc
ctgtatggcaccaagtacacgtacggcccaggagcctcgacaatctatcctgccgctggc
ggctccgatgactgggcttacgaccaaggaatcaaatactccttcacctttgaactccgg
gacacaggcagatatggctttgcgctccctgaatcccagatccgggcaacctgcgaggag
acgctgcgggccgtcaaatacgtggccagctacgtcctggagcatctgtactag

DBGET integrated database retrieval system