KEGG   Equus caballus (horse): 100058995Help
Entry
100058995         CDS       T01058                                 

Gene name
RNASE1, RAC1
Definition
ribonuclease, RNase A family, 1 (pancreatic)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 228 aa AA seqDB search
METDEMRNRKNPAEESADDSPGNGLPVIELSWPQGGRQKKRRGKEILHRCMEEMRRGRSS
ERRGLLRGSEATMAQEKSLILFPLLVLVLLVLGCVQLSLGKESPAMKFERQHMDSGSTSS
SNSTYCNQMMKRRNMTQGWCKPVNTFVHEPLADVQAICLQKNITCKNGQSNCYQSSSSMH
ITDCRLTSGSKYPNCAYRTSQKERHIIVACEGNPYVPVHFDASVEVST
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagacgaaatgcgtaatagaaagaatccagctgaagagtcagcagatgattct
ccagggaacggacttcctgttatagaattgtcatggcctcagggaggaagacaaaagaag
agaaggggcaaggagattctgcacagatgtatggaagagatgagaaggggaagaagctca
gaaaggagagggctcctcaggggtagtgaggccaccatggctcaggagaagtctctcatc
ctgttcccactgctggtcctggtgctgctggtgctggggtgtgtccagctttccctcggc
aaggaatcacccgccatgaagtttgagcggcagcacatggactcaggcagcacctccagc
agtaactccacttactgcaaccaaatgatgaagcgacggaatatgacacagggatggtgc
aagcccgtgaacacctttgtgcatgagcccctggcagatgtccaggccatctgcctccag
aaaaacataacctgcaagaacgggcagtccaactgctaccagagcagctccagcatgcac
attacagactgccgcctcacgagcggctccaagtaccctaactgtgcataccggaccagc
cagaaagagagacacatcatcgtggcctgtgaggggaacccgtatgtgccagtccacttt
gacgcttctgtggaggtctccacttga

DBGET integrated database retrieval system