KEGG   Equus caballus (horse): 100059111Help
Entry
100059111         CDS       T01058                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta subunit 4 isoform X2
  KO
K03505  DNA polymerase delta subunit 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb00240  Pyrimidine metabolism
ecb01100  Metabolic pathways
ecb03030  DNA replication
ecb03410  Base excision repair
ecb03420  Nucleotide excision repair
ecb03430  Mismatch repair
ecb03440  Homologous recombination
ecb05166  HTLV-I infection
Module
ecb_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100059111 (POLD4)
   00240 Pyrimidine metabolism
    100059111 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100059111 (POLD4)
   03410 Base excision repair
    100059111 (POLD4)
   03420 Nucleotide excision repair
    100059111 (POLD4)
   03430 Mismatch repair
    100059111 (POLD4)
   03440 Homologous recombination
    100059111 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100059111 (POLD4)
DNA replication proteins [BR:ecb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100059111 (POLD4)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100059111 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100059111 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100059111
NCBI-ProteinID: XP_001497402
Ensembl: ENSECAG00000010008
UniProt: F7B8J0
Position
12
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHCKGELAPDLGEEPQPLNVDEAELELLRQFDLAWQYGP
CTGITRLQRWHRAKQMGLEPPLEVYQVLQTHPGDPRVQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggagggagggcccc
gctggacactgcaagggggagctggcaccagacctaggggaagagccccagcccctgaat
gtggatgaagccgagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgtacagggatcacacggctgcagcgctggcatcgggcaaagcagatgggcttggagcct
cccttagaagtgtatcaggtgctgcagacccaccctggagatccccgtgtccagtgcagc
ctctggcatctctatcccctttga

DBGET integrated database retrieval system