KEGG   Equus caballus (horse): 100059111Help
Entry
100059111         CDS       T01058                                 

Gene name
POLD4
Definition
(RefSeq) polymerase (DNA-directed), delta 4, accessory subunit
  KO
K03505  
DNA polymerase delta subunit 4
Organism
ecb  Equus caballus (horse)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100059111 (POLD4)
   00240 Pyrimidine metabolism
    100059111 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100059111 (POLD4)
   03410 Base excision repair
    100059111 (POLD4)
   03420 Nucleotide excision repair
    100059111 (POLD4)
   03430 Mismatch repair
    100059111 (POLD4)
   03440 Homologous recombination
    100059111 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100059111 (POLD4)
DNA replication proteins [BR:ecb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100059111 (POLD4)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100059111 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100059111 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHCKGELAPDLGEEPQPLNVDEAELELLRQFDLAWQYGP
CTGITRLQRWHRAKQMGLEPPLEVYQVLQTHPGDPRVQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggagggagggcccc
gctggacactgcaagggggagctggcaccagacctaggggaagagccccagcccctgaat
gtggatgaagccgagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgtacagggatcacacggctgcagcgctggcatcgggcaaagcagatgggcttggagcct
cccttagaagtgtatcaggtgctgcagacccaccctggagatccccgtgtccagtgcagc
ctctggcatctctatcccctttga

DBGET integrated database retrieval system