KEGG   Equus caballus (horse): 100059197Help
Entry
100059197         CDS       T01058                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3 isoform X1
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04260  Cardiac muscle contraction
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04921  Oxytocin signaling pathway
ecb05410  Hypertrophic cardiomyopathy (HCM)
ecb05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ecb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100059197 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100059197 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    100059197 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100059197 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100059197 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100059197 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    100059197 (CACNA2D3)
Ion channels [BR:ecb04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100059197 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 dCache_1 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE Phage_holin_6_1
Motif
Other DBs
NCBI-GeneID: 100059197
NCBI-ProteinID: XP_023476977
Ensembl: ENSECAG00000014305
Position
16
AA seq 1091 aa AA seqDB search
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CIQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLADDQGLVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
PLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSTGTVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEVEGAVMNKLLTMGSFKRITL
YDYQAMCRANKESSDGAYGLLDPYNAFLAAVKWIMTELVLFLVEFNLCSWWHSDITAKAQ
KLKQTLEPCDTEYPAFVSERTIKETSGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE
SIAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPGIQAKMVLI
LFPLLLMLFSR
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggctcgccgcgccgcgcgtcccggggggcctcggcgctcctcgccgcc
gcgcttctctacgccgcgctgggggacgtggtgcgctcggagcagcagatcccgctctcc
gtggtgaagctctgggcctcggcttttggtggggagataaaatccattgctgctaagtac
tccggctcccagcttctgcaaaagaaatacaaagaatatgagaaagatgttgccatagaa
gaaatcgatggtctccaactggtgaaaaagctggcaaagaacatggaagagatgtttcac
aaaaagtcggaagcagtgaggcgtcttgtggaggctgcagaagaagcacacctgaaacat
gaatttgatgcagacttgcagtatgaatacttcaatgccgtgctgataaacgaaagggac
aaagatgggaattttttggagctggggaaggaattcatcttagccccaaatgaccatttt
aataatttgcctgtgaacatcagtctgagtgacgtccaagtgccaacgaacatgtacaac
aaagacccagcaattgtcaatggggtttattggtccgaatctctaaacaaagtctttgta
gataattttgaccgtgacccgtctctcatctggcagtactttggaagtgcaaagggcttt
tttaggcagtatccagggattaaatgggaaccagatgagaatggagtcattgcctttgac
tgcaggaaccgaaaatggtacatccaggcagcaacttctccgaaagacgtggtcatttta
gttgacgtcagtggcagcatgaaagggctccgtctgacgattgcaaagcaaacggtctca
tctattttggatacgctgggggatgacgacttcttcaacataattgcttataacgaggag
cttcactatgtggaaccttgcctgaatggaacgttggtgcaagccgacaggacaaacaag
gagcatttcagggagcatctggacaaactttttgccaaaggaatcggaatgctggatata
gctctgaatgaggccttcaacattctcagtgatttcaaccacacaggacaaggaagcatc
tgcatccaggccatcatgctcattaccgatggggcagtggacacctatgatactatcttt
gcgaaatacaattggccagatcgaaaggttcgcatcttcacgtacctcattggacgagag
gctgcttttgcagacaatctcaagtggatggcctgtgccaacaaaggatttttcacccag
atctccaccttggctgatgtgcaggaaaatgtcatggaatacctccacgtgctcagccgg
cccaaagtcattgaccaagagcacgacgtggtgtggacagaagcttacattgacagcact
ctccctcaggcacaaaagcttgctgatgatcagggccttgtcctcatgaccacggtcgcc
atgcccgtgtttagtaagcagaatgaaaccagatcaaaaggcattcttctgggcgtggtt
ggcacagatgtcccagtgaaagaacttctgaagaccattcccaaatacaagttagggatt
cacggttatgcctttgcaatcacaaataatggatatatcctgacgcatccagaactcaga
ccactgtacgaagaaggaaaaaagcgaaggaaacccaactatagcagcgttgacctctct
gaggtggagtgggaagaccgagatgacgtgttgagaaatgccatggtgaatcgaaagact
gggaagttttccatggaggtgaagaagacagtggacaaagggaaacgggttttggtgatg
acaaatgactactattatacagacatcaagggtactcctttcagtttaggtgtggcactc
tccagaggccatgggaaatatttcttccgagggaatgtaaccattgaagaaggcctacat
gacttagagcatcctgatgtgtccttggcagacgaatggtcctactgcaacactgaccta
cacccagagcaccgtcatctgtctcagttagaagctattaagctctacctcaaaggcaaa
gaacctctgctgcagtgtgataaagaattgatacaggaagtccttttcgatgccgtagtg
agtgcccccatcgaagcatactggaccagccttgccctcaacaaatctgagaattctgac
aagggcgtagaggttgccttcctcggcactcgcacgggcctctcgagaatcaacctgttt
gttggggctgagcagctcaccaatcaggactttctgaaagctggagacaaggagaacatt
tttaatgcagaccatttccctctctggtaccgaagagccgctgagcagattccaggaagc
ttcgtctattcgattccgttcagcacaggaacagtcaacaaaagcaatgtggtgacagcg
agtacctccatacagctcctggatgagcggaaatctcctgtggtggcagctgtaggcatt
cagatgaaacttgaatttttccaaaggaagttctggactgccagcagacagtgcgcctct
ctggatggcaaatgctccatcagctgcgatgacgagactgtgaactgttacctcatagac
aataatggatttattctggtatcggaagactacacacagactggagacttttttggtgag
gtcgagggagctgtgatgaacaaattgttaacaatgggctcctttaaaaggattaccctt
tatgactatcaagccatgtgcagggccaacaaggagagcagcgatggtgcctatggtctg
ctggatccttataatgccttccttgctgcagtaaaatggataatgacagaacttgtcttg
ttcctggtggaatttaacctctgcagttggtggcactcagatataacagctaaagcccag
aaattgaagcagaccttggagccttgtgatactgaatatccagcgtttgtctctgagcgc
accatcaaggaaacctcagggaacattgcttgcgaagactgctccaagtcctttgtcatc
cagcaaatcccaagcagcaatctgttcatggtggtggtggacagcagctgcctctgtgag
tccatagcccccatcaccatggcgcccattgaaatcaggtataacgaatcccttaagtgt
gaacgcttaaaggcccagaagatcagaaggcgtccggagtcttgtcatggcttccatcct
gaggaaaacgcaagagagtgtggaggtgcaccgggcatccaagccaagatggtccttatc
ctgttccctctgcttttgatgctcttctcaaggtga

DBGET integrated database retrieval system