KEGG   Equus caballus (horse): 100059233Help
Entry
100059233         CDS       T01058                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ecb  Equus caballus (horse)
Pathway
ecb03015  mRNA surveillance pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04114  Oocyte meiosis
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04390  Hippo signaling pathway
ecb04510  Focal adhesion
ecb04611  Platelet activation
ecb04720  Long-term potentiation
ecb04728  Dopaminergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04931  Insulin resistance
ecb05031  Amphetamine addiction
ecb05034  Alcoholism
ecb05168  Herpes simplex infection
ecb05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100059233 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100059233 (PPP1CA)
   04024 cAMP signaling pathway
    100059233 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    100059233 (PPP1CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100059233 (PPP1CA)
   04218 Cellular senescence
    100059233 (PPP1CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100059233 (PPP1CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100059233 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100059233 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    100059233 (PPP1CA)
   04921 Oxytocin signaling pathway
    100059233 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100059233 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100059233 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    100059233 (PPP1CA)
   04720 Long-term potentiation
    100059233 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100059233 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100059233 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    100059233 (PPP1CA)
   05034 Alcoholism
    100059233 (PPP1CA)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100059233 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    100059233 (PPP1CA)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100059233 (PPP1CA)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100059233 (PPP1CA)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100059233 (PPP1CA)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100059233 (PPP1CA)
Spliceosome [BR:ecb03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100059233 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100059233
NCBI-ProteinID: XP_023510324
Ensembl: ENSECAG00000010532
Position
12
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctatcatcgggcgcttgctggaagtgcag
ggctcacggcctggaaagaatgtacagctgacagagaacgagatccgtggtctgtgcctc
aaatcccgggagatcttcctgagccagccaattcttctggagctggaggcgcccctcaag
atctgtggtgacatccatggccagtactacgatcttctgcggctgttcgagtatggtggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtaccccgagaacttcttcctg
ctccgcgggaaccatgagtgtgccagcatcaaccgcatctacggtttctatgatgagtgc
aagagacgctacaacattaaactgtggaaaaccttcaccgactgcttcaactgcctgccc
atcgctgccatcgtggacgagaagatcttctgctgccacggagggctgtcgcccgacctg
cagtccatggaacagattcggcgtatcatgcggcccacagacgtgcctgaccaggggctg
ctgtgtgacctgctgtggtccgacccggacaaggacgtgcagggctggggcgagaacgac
cgtggggtctcctttactttcggggctgaggtggtggccaagttcctgcacaagcacgat
ttggacctcatctgccgggcgcaccaggtggtggaagatggctatgagttctttgccaag
cggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgcaggt
gccatgatgagcgtggacgagacgctcatgtgctccttccagatcctcaagcccgcggac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

DBGET integrated database retrieval system