KEGG   Equus caballus (horse): 100059254Help
Entry
100059254         CDS       T01058                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100059254 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100059254 (SETDB1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100059254 (SETDB1)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100059254 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100059254 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1299 aa AA seqDB search
MTSLPGCIGLDAATAAVESEEIAELQKAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPVEPSQPTAPPVQPVPPAPPLSPQAGDSESLES
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVPGGKPGITQTYRSPLGSTTSAPA
PPAPPAPPAPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSE
QYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDF
LFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERI
PGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEE
CLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIY
AGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGN
SGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGVSETASKDSRPPDL
GPPHIPVPPSIPIGGCNPPSSEETPKNKVASWLSCNNVSEGGFADSDSRSSFKTSEGGEG
RAGGGRGEAEKASTSGLGFKDEGDIKQAKKEDPDDRNKMSIVTESSRNYGYNPSPVKLEG
LRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDD
IQTISSGSEGDDFEDKKNMSGPLKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAP
VRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFAS
KRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgacctccctccctgggtgcattggtttggatgcagcaacagctgcagtggagtctgaa
gagattgcagagctgcaaaaagcagtggttgaggagctgggtatctctatggaggagctt
cgacagttcatcgatgaggaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcggagttggagacatgggtaatacagaaagagtctgaggtggcccatgttgaccag
ctctttgatgatgcctccagggcagtgactaattgtgagtctttggtgaaggacttttac
tccaaactgggactacagtaccgggacagtagctctgaggatgaagcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccgaaagaccagaagctccgtgaagctatggctgccttaagaaagtcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagcagttcccaggattta
cataaaggaaccttgagtcagatgtctggagaattgagcaaagatggtgacctgatagtc
agcatgcgcatcctgggcaagaagagaactaaaacatggcacaaaggcacccttattgcc
atccagacggttgggccaggaaagaagtacaaggtgaaatttgacaacaaaggaaagagt
ttactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtatgtg
ggcagtcgagtggtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttttttgatgatggc
tatgcttcctatgtcacacaatctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaggaatatatcactgcttac
cccaatcgccccatggtgctgctcaagagtggccagcttatcaagacagagtgggaaggc
acatggtggaagtcccgagtcgaggaggtggatggcagcctcgtcaggatcctcttcctg
gatgacaaaagatgtgaatggatctatcgaggctctacacggctggagcccatgttcagc
atgaagacatcctcggcgtctgcactggaaaagaagcaagggggacagctcaggacacgt
ccaaatatgggtgctgtgaggagcaaaggccctgtggtccagtacacccaggatctgacc
agtactggaacccaattcaagccagtggagccctcacagcctacagccccacctgtccaa
cctgtcccacctgccccacctctgtccccccaggctggtgacagtgaaagcttagaaagc
cagcttgcccaatcacggaagcaggtagccaaaaagagcacttccttccggccaggatct
gtgggctctggtcattcctcccctacgtcccctgcactcagtgaaaatgtccctggtggg
aaacctgggatcacccagacgtacagatcacctttaggctcaacaacctctgccccagca
cccccagcccctccagctcctccagcccctccagcgcctccagcgcctccagccttccat
ggcatgctggagcgggcccccgcggaaccctcctaccgcgcccctatggagaaacttttc
tacttacctcatgtctgtagctatacttgtctgtctcgagtcagacctatgagaagtgag
caataccggggcaagaaccctctgctagttccactgctgtatgacttccggcggatgaca
gcccggcgccgagttaaccgcaagatgggctttcatgttatctataagacaccctgtggc
ctctgccttcggacaatgcaggagatcgaacgatacctttttgagactggctgtgacttt
ctcttcctggagatgttctgtttggatccgtatgttcttgtggaccggaagtttcagccc
tataagcctttttactatatcttggacatcacctatgggaaggaagatgttcccctatcc
tgtgtcaatgagattgacacaactcccccaccccaggtggcctacagcaaggaacgaatc
ccgggcaagggtgttttcattaacacaggccctgaatttctggttggctgtgactgcaag
gatgggtgccgggacaagtccaagtgtgcctgccatcaactaactatccaggctacagcc
tgcaccccaggcggccaaattaaccctaactctggctaccagtacaagagactagaagag
tgtctgcccacgggagtttatgagtgtaataaacgctgcaaatgtgacccaaacatgtgc
acaaaccggttggtgcagcatggactacaggttcggctacagctattcaagacacagaac
aagggttggggtatccgctgcttggatgacattgccaaaggctcctttgtctgtatttac
gcaggcaaaatcctgacagatgactttgcagacaaggagggcctggaaatgggtgatgag
tactttgccaatctggaccatatcgagagtgtggagaacttcaaggaaggatatgagagt
gatgccccctgttcctctgacagcagtggtgtagacttgaaggaccaggaagatggcaac
agtggtacagaagacccagaagagtccaatgatgatagctcagatgataacttctgtaag
gatgaggacttcagcaccagctcagtatggcgcagctatgctacccggcggcagacccgg
ggccagaaggagaatggagtgtctgagacagcttccaaggattcccgccctccagacctt
gggcccccacatattcctgtccctccatcaatccctataggtggctgcaatccaccttcc
tctgaagagacacccaagaataaggtggcttcgtggttgagctgcaataatgtcagtgaa
ggtggctttgctgactctgatagtcgttcatctttcaagactagcgaaggtggggaaggc
cgggctgggggaggcagaggggaggctgagaaggcctccacctcagggctgggcttcaag
gatgagggagacatcaagcaggccaagaaagaggaccccgatgaccgaaacaagatgtca
atagttactgaaagctctcgaaattatggttataatccttctcctgtgaagcttgaagga
cttcgccggccacctagtaagactagtatgcatcagagccgacgactcatggcctctgct
cagtccaaccctgatgatgtcctgacactgtccagcagcacagaaagtgagggggaaagt
gggaccagccgaaagcccactgctggtcagacttcagccacagcggttgacagtgatgat
atccagaccatctcctctggctctgaaggggatgactttgaggacaagaagaacatgtct
ggtccattgaagcgccaagtggcagtaaaatcaacccgaggctttgctcttaaatcaacc
catgggattgccattaaatcaaccaacatggcttccgtggaaaaaggggagagcgctcct
gttcgtaagaacactcgccagttctacgatggtgaggagtcttgctacatcatcgatgcc
aagcttgaaggcaacctgggccgttacctcaatcacagttgcagccccaacctgtttgtc
cagaatgtcttcgtggatactcatgatcttcgcttcccctgggtggccttctttgccagc
aagagaatccgggctgggacagaacttacttgggactacaactatgaggtgggcagtgtg
gaaggcaaggagctgctctgctgctgtggggccatcgaatgcagagggcgtcttctttag

DBGET integrated database retrieval system