KEGG   Equus caballus (horse): 100059254Help
Entry
100059254         CDS       T01058                                 

Gene name
SETDB1
Definition
SET domain, bifurcated 1
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100059254 (SETDB1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100059254 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1299 aa AA seqDB search
MTSLPGCIGLDAATAAVESEEIAELQKAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPVEPSQPTAPPVQPVPPAPPLSPQAGDSESLES
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVPGGKPGITQTYRSPLGSTTSAPA
PPAPPAPPAPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSE
QYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDF
LFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERI
PGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEE
CLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIY
AGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGN
SGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGVSETASKDSRPPDL
GPPHIPVPPSIPIGGCNPPSSEETPKNKVASWLSCNNVSEGGFADSDSRSSFKTSEGGEG
RAGGGRGEAEKASTSGLGFKDEGDIKQAKKEDPDDRNKMSIVTESSRNYGYNPSPVKLEG
LRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDD
IQTISSGSEGDDFEDKKNMSGPLKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAP
VRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFAS
KRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgacctccctccctgggtgcattggtttggatgcagcaacagctgcagtggagtctgaa
gagattgcagagctgcaaaaagcagtggttgaggagctgggtatctctatggaggagctt
cgacagttcatcgatgaggaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcggagttggagacatgggtaatacagaaagagtctgaggtggcccatgttgaccag
ctctttgatgatgcctccagggcagtgactaattgtgagtctttggtgaaggacttttac
tccaaactgggactacagtaccgggacagtagctctgaggatgaagcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccgaaagaccagaagctccgtgaagctatggctgccttaagaaagtcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagcagttcccaggattta
cataaaggaaccttgagtcagatgtctggagaattgagcaaagatggtgacctgatagtc
agcatgcgcatcctgggcaagaagagaactaaaacatggcacaaaggcacccttattgcc
atccagacggttgggccaggaaagaagtacaaggtgaaatttgacaacaaaggaaagagt
ttactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtatgtg
ggcagtcgagtggtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttttttgatgatggc
tatgcttcctatgtcacacaatctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaggaatatatcactgcttac
cccaatcgccccatggtgctgctcaagagtggccagcttatcaagacagagtgggaaggc
acatggtggaagtcccgagtcgaggaggtggatggcagcctcgtcaggatcctcttcctg
gatgacaaaagatgtgaatggatctatcgaggctctacacggctggagcccatgttcagc
atgaagacatcctcggcgtctgcactggaaaagaagcaagggggacagctcaggacacgt
ccaaatatgggtgctgtgaggagcaaaggccctgtggtccagtacacccaggatctgacc
agtactggaacccaattcaagccagtggagccctcacagcctacagccccacctgtccaa
cctgtcccacctgccccacctctgtccccccaggctggtgacagtgaaagcttagaaagc
cagcttgcccaatcacggaagcaggtagccaaaaagagcacttccttccggccaggatct
gtgggctctggtcattcctcccctacgtcccctgcactcagtgaaaatgtccctggtggg
aaacctgggatcacccagacgtacagatcacctttaggctcaacaacctctgccccagca
cccccagcccctccagctcctccagcccctccagcgcctccagcgcctccagccttccat
ggcatgctggagcgggcccccgcggaaccctcctaccgcgcccctatggagaaacttttc
tacttacctcatgtctgtagctatacttgtctgtctcgagtcagacctatgagaagtgag
caataccggggcaagaaccctctgctagttccactgctgtatgacttccggcggatgaca
gcccggcgccgagttaaccgcaagatgggctttcatgttatctataagacaccctgtggc
ctctgccttcggacaatgcaggagatcgaacgatacctttttgagactggctgtgacttt
ctcttcctggagatgttctgtttggatccgtatgttcttgtggaccggaagtttcagccc
tataagcctttttactatatcttggacatcacctatgggaaggaagatgttcccctatcc
tgtgtcaatgagattgacacaactcccccaccccaggtggcctacagcaaggaacgaatc
ccgggcaagggtgttttcattaacacaggccctgaatttctggttggctgtgactgcaag
gatgggtgccgggacaagtccaagtgtgcctgccatcaactaactatccaggctacagcc
tgcaccccaggcggccaaattaaccctaactctggctaccagtacaagagactagaagag
tgtctgcccacgggagtttatgagtgtaataaacgctgcaaatgtgacccaaacatgtgc
acaaaccggttggtgcagcatggactacaggttcggctacagctattcaagacacagaac
aagggttggggtatccgctgcttggatgacattgccaaaggctcctttgtctgtatttac
gcaggcaaaatcctgacagatgactttgcagacaaggagggcctggaaatgggtgatgag
tactttgccaatctggaccatatcgagagtgtggagaacttcaaggaaggatatgagagt
gatgccccctgttcctctgacagcagtggtgtagacttgaaggaccaggaagatggcaac
agtggtacagaagacccagaagagtccaatgatgatagctcagatgataacttctgtaag
gatgaggacttcagcaccagctcagtatggcgcagctatgctacccggcggcagacccgg
ggccagaaggagaatggagtgtctgagacagcttccaaggattcccgccctccagacctt
gggcccccacatattcctgtccctccatcaatccctataggtggctgcaatccaccttcc
tctgaagagacacccaagaataaggtggcttcgtggttgagctgcaataatgtcagtgaa
ggtggctttgctgactctgatagtcgttcatctttcaagactagcgaaggtggggaaggc
cgggctgggggaggcagaggggaggctgagaaggcctccacctcagggctgggcttcaag
gatgagggagacatcaagcaggccaagaaagaggaccccgatgaccgaaacaagatgtca
atagttactgaaagctctcgaaattatggttataatccttctcctgtgaagcttgaagga
cttcgccggccacctagtaagactagtatgcatcagagccgacgactcatggcctctgct
cagtccaaccctgatgatgtcctgacactgtccagcagcacagaaagtgagggggaaagt
gggaccagccgaaagcccactgctggtcagacttcagccacagcggttgacagtgatgat
atccagaccatctcctctggctctgaaggggatgactttgaggacaagaagaacatgtct
ggtccattgaagcgccaagtggcagtaaaatcaacccgaggctttgctcttaaatcaacc
catgggattgccattaaatcaaccaacatggcttccgtggaaaaaggggagagcgctcct
gttcgtaagaacactcgccagttctacgatggtgaggagtcttgctacatcatcgatgcc
aagcttgaaggcaacctgggccgttacctcaatcacagttgcagccccaacctgtttgtc
cagaatgtcttcgtggatactcatgatcttcgcttcccctgggtggccttctttgccagc
aagagaatccgggctgggacagaacttacttgggactacaactatgaggtgggcagtgtg
gaaggcaaggagctgctctgctgctgtggggccatcgaatgcagagggcgtcttctttag

DBGET integrated database retrieval system