KEGG   Equus caballus (horse): 100059297Help
Entry
100059297         CDS       T01058                                 

Gene name
PNPLA7
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100059297 (PNPLA7)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100059297 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 1260 aa AA seqDB search
MEQEDTSPELMGIAIGALLALALVGVTVFFMYRKFSQFGQVQPTPQYRFRKRDKVMFYGR
KIMRKVTTLPNTLVGNTAAPRQRVRKRTKVLSLAKRILRFKKEYPTLQPKEPPPSLLEAD
LTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMVFVQLLEGEHVFRPGEPDTS
IYVVQDGRLEVCIQDTDGTEVAVKEVLAGDSVHSLLSILDVITGHTAPYKTVSARAAAAS
TVLRLPAAAFQGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNPESQAIPL
VSVASLAVGKTKRQVSCSPEERLEKSLRPQESCDPDHGGSRAAASGPLLKRSHSVPLPSV
HKEISDELGKAQAGDKAPSAPPGSVAGAPSDLRMACDRARVVLQAEERPASAVASKSKKS
VVVAETPSAVFHYEDSTSDETAASRKTDAIFRAAKKDLLTLMKLDDPSLLDGRVTLLHVP
GGTVVSRQGDQDVNILFVVSGLLHVYQRKIDSEEDTCLFVTRPGEMVGQLAVLTGEPLIF
TIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAHTLVKRMSSFVRQIDFALDWMEVEAGR
AIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEYGRGDLIGVVETLTHQARATTVHA
VRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGTATGHQFGLHAAGGKWD
SGNPPSNLSTVAVMPVSEDVPLTTFALELKHALSAIGPVLLLTSDNIKQRLGSAALDSIH
EYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGEQEPTVGEVEMYER
VFQRPPDRHSDFSRLARVLTGNAIALVLGGGGARGCAQVGIIRALVECGIPVDMVGGTSI
GAFMGALYSEERSCSQMRIRAKQWAEGMTSVVRTMLDLTYPITSMFSGAGFNNSICSVFK
DRQIEDLWIPYFTITTDITASAMRVHTDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDG
GYINNLPADVARSMGAKVVIAIDVGSQDEVDLTNYGDALSGWWLLWKRWNPLATKVKVLN
MAEIQTRLAYVCCVRQLEMVKSSDYCECLRPPIDRYRTLDFGKFDEICEVGYQHGRTVFD
IWGRSGVLEKMLQDRQGTSRMKACDALTCPNASFTDLAEIVSRIEPAKVAAVDDESDYQT
EYEEELLEGPQDAYADFQCAPADSGSDSEDEPSLQHQDPSLASAKLSRDSSSLWLSDQDG
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagaggacaccagcccagagctgatggggattgcgattggagcgctcctggcc
ctggccctcgttggcgtcaccgtctttttcatgtacagaaagtttagtcagttcggacag
gtgcagcccactcctcagtacaggttccggaagagagacaaagtgatgttttacggccga
aagatcatgagaaaggtaaccacgctccccaacacacttgtggggaacacagccgcaccc
cggcagcgggtgaggaagaggaccaaggtgctgtctttggccaagaggattctgcgtttc
aagaaggaataccctaccctccagccaaaggagcccccaccctccctgctggaggctgac
ctcacagaatttgacgtgaagaattctcacctgccgtcggaagtgttgtacatgctgaaa
aatgttcgggtcctgggccactttgagaagccactgttcctggaactttgcaaacacatg
gtctttgtgcagctgctcgaaggggagcatgtcttccggccgggggagccagacaccagc
atctatgtggtgcaggatgggcggctggaagtctgcatccaggacacagacggcacggag
gtggcggtcaaagaggttctggctggcgacagcgtgcacagtctcctcagcatcctggat
gtcatcactggccacactgcaccgtacaaaacagtgtcagcccgtgccgctgccgcatcc
actgtcctccggcttccagccgcggctttccaaggagtttttgagaaataccctgaaacc
ctcgtgagggtggtgcagatcatcatggtgcggctgcagagggtcacctttctggctctg
cacaactacctgggcctcaccacggagctcttcaaccccgagagccaggccatccccctc
gtgtctgtagccagtctggctgttggaaagaccaagaggcaggtgagctgcagccctgag
gagcgactcgagaagtccctgcggcctcaggagtcctgcgacccagatcatgggggcagc
cgtgcagcagcctctgggcctctgctgaagaggagccattccgtcccactgccttctgtc
cacaaagagatctcggatgagctcggcaaggcccaggcaggtgacaaggccccttcggct
ccaccagggagcgtcgcaggtgccccctcagacctgaggatggcctgtgaccgcgccagg
gttgtcctgcaggcagaggagcgccctgcgagtgccgtggccagcaagtccaagaaaagc
gtggtggttgcggagacaccatctgcagtcttccactacgaggacagcacttcggatgag
actgctgccagcaggaagacagatgccatcttcagagctgccaagaaggacctgctcact
ctgatgaagctggatgacccttcactgttggatggccgggtgacccttctccatgtccct
gggggcacggtggtgtcaaggcagggagaccaggatgtgaacatcctcttcgtggtctcg
ggactgctgcacgtgtaccagcgaaagatcgacagcgaggaggacacctgcctgttcgtc
acacgccctggggagatggtgggccagctggccgtgctcaccggcgaacccctcatcttc
accatcaaggccaacagggactgcagcttcctctccatctccaaggcacacttctatgag
atcatgcggaagcagccaactgttgtgctgggcgtcgcgcacaccctggtgaagcggatg
tcttcctttgtgcggcaaattgattttgcgctggactggatggaggtggaggcggggcgc
gccatctacaggcagggggacaagtcagactgtacctacatcgtcctcagtggccggcta
cgctcagtgatccgaaaggacgatggcaaaaagcgcctggcgggggagtatggccgagga
gacctcatcggtgtggtggagaccctcacccaccaggccagggcgaccacagtgcatgca
gttcgggactcagagctggccaagcttccggcaggagccttaacatccatcaagcgcagg
tacccacaggttgtgactcggctgattcacctcttgggcgagaagatcctgggcagcctt
cagcagggaactgcaacaggtcaccagtttgggctacatgctgcaggcggcaagtgggac
tcagggaacccccccagcaacctgtccacagtggccgtgatgcccgtgtcagaggacgtg
cccctcaccaccttcgccctggagctcaagcacgccctcagtgccattggccccgtcctg
ctgctgaccagcgacaacataaaacagcgccttggctctgctgctctggacagcatccat
gagtatcggctgtccagctggctggggcagcaggaggacatccaccggattgtgctttac
caggcagacagcacactcacgccctggacccagcgctgcatccggcaagctgactgcatc
ctcatcgtgggtctaggggagcaggagcccacagtgggcgaggtggagatgtacgagcgg
gtcttccagaggcccccagaccggcactcggacttctctcgcctggcacgggtgttgacc
ggcaatgccatcgccttggtgcttggaggagggggagcaagaggctgtgcccaggtgggc
atcatccgggccctggtggagtgcggtatccccgtggacatggtcggagggacgtccatt
ggggccttcatgggtgccctgtactctgaggagcggagctgcagccagatgcggatccgg
gccaagcagtgggccgagggtatgacgtctgtggtgaggaccatgctggacctgacctac
cccatcacctccatgttctcgggagccggcttcaacaacagcatctgtagcgtcttcaag
gaccggcagatcgaggacctgtggatcccctacttcaccatcaccacagacatcactgcc
tcagccatgcgggtccacacagatggctccctgtggaggtatgtgcgtgcaagcatgtcc
ctgtcagggtacatgccccccctctgcgaccccaaagatggacacctgctgatggacggt
ggctacatcaacaacctcccagcggatgtggccaggtcgatgggggcaaaggtcgtgatt
gccattgacgtgggcagccaggacgaggtggacctgaccaactatggcgatgcactgtct
gggtggtggctgctgtggaagcgctggaaccccttggccacgaaagtcaaggtgttgaac
atggcagagatccagacgcgcctggcctatgtgtgctgcgtccggcagctggagatggtg
aagagcagcgactactgcgagtgcctgcgcccgcccattgaccgctaccgcaccctggac
tttggcaaattcgatgagatctgtgaagtggggtaccagcacgggcggacggtgtttgac
atctggggtcgaagtggtgtgctggagaagatgctacaggaccggcaggggacgagcagg
atgaaggcctgcgatgctcttacctgccccaatgcctccttcacggatcttgccgagatt
gtgtcacgaatcgagcctgccaaggtggctgcagtggatgacgaatctgactaccagact
gagtacgaggaggagctgctcgagggcccccaggatgcatacgccgacttccagtgcgcc
ccggctgactcaggctctgactcggaggatgagccctcacttcagcatcaggaccccagt
ctggcttctgcaaaactgtcccgggactcctcatccctctggctgtctgaccaagatggg
tag

DBGET integrated database retrieval system