KEGG   Equus caballus (horse): 100059339Help
Entry
100059339         CDS       T01058                                 

Gene name
USP29
Definition
ubiquitin specific peptidase 29
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 951 aa AA seqDB search
MAPLRIHGFIQIWSKKTGITKSREVFIETVEGKKETSLVVIFNSGEFIRVFQLSNNITNV
VLRHCGERQSCLNLTLKNNSSLFIDKLSRRDAEQLKMFLDIVHQNEFQSPMESDSDWRVF
DSRNTRKEIDKTPFHKVCDMPSYGFFNTEKVSETPFPQKMPSLISKSPMLVTTGLLENQG
GKGKRMQSSCLEMSEGLWEENNPILNKKLKTNSFKYVSGIGKKPLHLKDPKRDRNSKYGP
SCKTISAXNPNLDKALHSVQLLSSKSSLEFRSGLMSSQNDPGCNESQVPLDSHPEQLWQG
FPNLGNTCYVNASLQSLFAIPLFADDLLKQGVPWEKIPFGALVMDLNQLLVLKGVCNVET
KKGLLVNVKSTISVVAETFSSNIQNDAHEFLGHCLDQLKEDMKKLNTTLRTERELGDENS
SPQRYAGNAATKSFVCLAVANFEFELQCSIICKACGQVVLKAEPSHYLSINLPQETKPLP
FSIQNCFDFFFRAEEPECNCEKCKHKSSVAKHKFSRLPRVLIVHLKCYNFSDVWXLVKDN
QRVHVPKYLSLSSHCNDNTKPLLPXGSNAPTGDSKVLNVSQEMISEIISPSTPSVMLISE
SSESLVLQIPSEKEAKPQNFRKICEGSSQEQQQRDLEKCSLNAVESELVNSGDGTVSEKE
LLAADSMDQGDISLPMICEDAGKPTSSPRTGLVEIHLQEVADNPELKKYEKTNAFVEXSV
TESTEDFCEDKETWIPERSEGMAEQLQXHDGKRIYEXFLQGEPPPSIGKPDAQEHIEKDL
NSPQKANLNSLGALGSDKNSGNKDILDTENTEAEAREPKRNTQMRDPLHAYQLISVVSHL
GHSPHSGHYISDVYDFQRXAWFTYSDLRVSQIEKSVMQEARLCTGYIFFYTHNEIFEALL
GKAENSQVLRTEVGKILQEKXEEDVSLHKSLDCLTQSHFLHRRKILNAAGR
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctaaggatacatggttttatccaaatttggagcaagaagactgggataact
aaatctagagaagtattcattgaaacagtggaaggaaaaaaggaaaccagcctggtggtc
attttcaattctggagaatttataagggtttttcagctaagtaataatattacaaatgtg
gtccttagacattgtggagagagacaaagttgcctgaatttaactttgaaaaacaatagc
tccttgtttattgacaaattatcgcgcagagatgccgaacagttgaagatgttcctggat
atagtccatcaaaacgaattccaatcacctatggaatctgatagtgattggcgtgttttt
gacagcagaaatacacggaaggaaattgacaaaactccatttcacaaggtttgtgacatg
ccaagttatggattctttaatacagaaaaagtaagtgagacacctttccctcagaagatg
ccttcattaatatcaaaatcaccaatgcttgtcacaacaggcctattagaaaatcaaggt
ggaaaggggaaaagaatgcaatcatcttgtctagagatgagtgagggcctctgggaagaa
aataaccccatactaaacaagaaactgaagacaaattcctttaagtatgtaagcggcatt
gggaagaaaccactgcatttaaaagatccaaaaagggatagaaattcaaaatatggacct
tcatgcaagaccatctctgcttaaaatcctaacctagataaggctcttcattcagtccaa
cttctctcttccaaaagcagtttggaatttcgctcaggactaatgtctagccagaatgat
ccaggatgtaatgaatcccaggtgccccttgactctcacccagaacaactatggcaaggc
tttcctaatttgggaaatacctgttacgtgaatgcaagtttacagtcactatttgcaatt
ccactgtttgctgatgacttacttaagcaaggtgtcccatgggagaaaattccctttggt
gctcttgttatggacttgaaccagttactggtgttaaaaggtgtctgtaacgtggagacc
aagaaagggttacttgtaaatgttaaaagtaccatttcagtggttgcagagacattctct
agcaacattcagaatgatgctcatgagttcttaggtcactgtttagatcagctgaaagag
gacatgaaaaaattaaacaccactttgaggactgagagagaacttggggatgaaaattcg
tctccacagaggtatgctggtaatgctgccaccaagtcatttgtttgtcttgctgttgct
aattttgagtttgaattgcagtgctccattatttgtaaagcctgtggtcaggtggttctc
aaggcagaaccgagtcattatctctccatcaaccttccccaagaaacaaaaccacttcct
ttctctattcaaaattgttttgattttttctttagagcagaagaacctgagtgtaactgt
gagaagtgcaagcacaagagttctgttgcaaagcacaaattcagtaggcttcccagggtc
cttattgttcatctgaaatgctataactttagtgatgtttggtagctagtgaaggataac
cagcgagtccatgttcccaaatatttaagcttgtcttctcattgcaatgataataccaaa
ccactgcttcctntgggcagtaatgcacctactggggactccaaagtcctgaatgtctct
caagagatgatttctgagatcatcagcccatcaacaccttcagtaatgttgatctcagaa
tccagtgagtccctggttttacaaattccatcagagaaggaagccaaaccacaaaatttc
cggaaaatctgtgaagggtccagccaagaacagcagcagagagacctggaaaagtgttct
ctgaatgcagtagagtcagaactggtaaactcaggagatgggacagtcagtgaaaaggag
ctgctagcagctgactcgatggatcaaggagatatttctcttcctatgatctgtgaagat
gcaggtaaacctaccagcagtccacgcacaggtcttgtagagattcatcttcaagaggta
gctgacaacccagaacttaagaaatatgagaaaaccaacgcatttgtagagnttagtgtc
actgagtctactgaagatttttgtgaggataaagaaacctggattccagaaagatctgaa
ggaatggctgaacaactccagtagcatgatggaaagagaatctatgaataattccttcag
ggggaaccacctccaagcattgggaagccggatgcccaggaacacatagagaaggacctc
aatagtcctcagaaggctaacctgaattcccttggtgcgttgggttccgataagaactct
ggaaacaaagacattttagatacagagaacacagaagctgaagccagagaaccgaaaaga
aatacccagatgagagaccctcttcatgcctaccagctcatcagtgtggtcagccatctt
gggcactccccacactcaggccattacatcagcgatgtttatgactttcagaggtaggcc
tggttcacgtacagtgatttacgagtatcacaaatcgaaaagtccgtaatgcaggaggct
aggctttgcactgggtatatcttcttttacacgcacaatgagatctttgaggcactgttg
ggaaaggcagagaattcccaggtacttagaacagaggtagggaagatccttcaggagaaa
taagaggaagatgtctcattgcacaaatctcttgactgcctcacgcagtcccacttcctc
cacagaaggaaaattctgaacgctgccgggagatga

DBGET integrated database retrieval system