KEGG   Equus caballus (horse): 100059539Help
Entry
100059539         CDS       T01058                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
ecb  Equus caballus (horse)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100059539 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100059539 (ST6GAL1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100059539 (ST6GAL1)
Glycosyltransferases [BR:ecb01003]
 Terminal extension
  Sialyltransferase
   100059539 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 406 aa AA seqDB search
MIHSSLKKKFSFCVLVFLLFAVICVWKEKKKGSYYESLKLQTKELQMPRSPEKRAIGSGS
KFASSSSTQDPHRNTQGLSNPRSPAKAKPEGSFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGVKFSADVLRCRLRDEVNVSMVEATDFPFNTSEWEGYLPMEDIRTKAGP
WGKCAVVSSAGSLKSSQLGQEIDDHDAVMRFNGAPTASFQQDVGTKTTIRLMNSQLVTTE
GRFLKDSLYNEGILIVWDPSVYHSDIPKWYKNPDYSFFDNYKSYRKLHPDQPFYILKPQM
PWELWDIIQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKYF
DTACTMGAYHPLLFEKNMVKHLNQGTDEDIYLFGKATLPGFRSIRC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcactccagcttgaagaaaaaattcagcttctgtgtgctggtctttctcctgttt
gcggtcatctgtgtgtggaaggaaaagaagaaaggaagttactatgaatcccttaaattg
caaaccaaggaattacagatgccgaggagtccagagaaacgggccattgggtctggttcc
aagtttgcatcttcaagcagcacccaagacccccacaggaacacccagggcctcagcaat
cccaggagtccagccaaggccaaaccagagggctctttccaggtgtggaacaaggacagc
tcttccaaaaacctcatccccaggctgcagaagatctggaaaaattatctgagcatgaat
aagtacaaagtgtcctacaaggggccagggccgggtgtcaagttcagtgcagacgtcctg
cgctgccgcctccgggacgaagtgaatgtatccatggtagaggccacagattttcccttc
aacacctctgagtgggagggttacctgcccatggaggacattaggaccaaggctgggcca
tggggcaagtgtgctgtcgtctcatcagcgggatctctgaagtcctcccaactgggccaa
gaaatagatgatcatgatgcagtcatgaggtttaacggggcacccacagccagcttccaa
caagacgtgggcacgaaaaccaccattcgcctgatgaactctcagttggtcaccacagaa
gggcgcttcctcaaagacagtttgtacaatgaaggcatcctaattgtgtgggacccatcg
gtttaccattcagatatcccaaagtggtacaagaatcccgactacagtttctttgataac
tacaagagctatcgtaagctgcatcctgatcagcccttttacatcctcaagccccagatg
ccttgggagctgtgggacatcattcaagaaatctccccagaggagattcagcccaacccc
ccatcctccgggatgcttggcatcatcatcatgatgacgctgtgtgaccaggtggatatt
tacgagttcctcccatccaagcgcaagactgacgtgtgctactactaccagaagtacttt
gacaccgcctgcacaatgggtgcctaccacccactcctctttgagaagaatatggtgaag
cacctcaaccagggcacagatgaggacatttacctgtttggaaaagccacactgcctggc
ttccggagtattcgttgctga

DBGET integrated database retrieval system