KEGG   Equus caballus (horse): 100059547Help
Entry
100059547         CDS       T01058                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30
AA seq 567 aa AA seqDB search
MDMMDQVKCDAIKSGSPCGFPQRSCRPSLRSRATPHGAEAAGGGGGGGGGRGGVKRALRT
PAWAKLCKYQQELFGKGPPREHPGPSRARMSMQQWAGHGAERGGRRSGEASAPAWSTEMR
REGHGGPLTARASLGPLRPHKGPRAGLPPFLTCAPPPTLRTRGAPGRSPAPRGGSTTGGG
LMGGDRSSSTATAAGASRSGSRERVPPLFRRPAPFRRPAPAPDWPSIPDPGKDFRCYPRG
IERPPVLCGAAGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRL
DTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD
VIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD
DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEYVGCQHGTAA
NRMEPMDTDQGNNMLSAIQSEVAKNQLLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKT
LAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatggatcaagtcaagtgtgatgcaataaaaagtggatcgccttgtggcttc
ccacaaagatcctgccgcccaagcctcagatccagggcgacgcctcacggcgcagaagcc
gcgggaggaggaggaggtggaggaggaggaaggggaggggtaaagcgggcactccggacg
ccggcctgggcgaaactatgcaagtaccagcaggagctgttcgggaagggcccacctcgg
gagcatccgggccccagcagggcgcggatgtccatgcagcaatgggcagggcacggagcg
gagcgcgggggacggaggtctggcgaagcgtctgctccggcctggagcactgagatgcgg
cgtgagggacacggaggcccgctcacagcccgcgcatccctggggccgctcagaccgcac
aaagggccccgggccggcctcccgcctttcctcacctgcgctccgccgccgaccctccga
acccgcggcgcccccgggagaagccctgcgccgcgcgggggatcgacgacaggcggcggc
ctgatgggcggcgaccgctccagctccaccgccaccgccgccggggcctccaggtccggc
tcccgggaacgagtcccgcccctcttccgtcgccccgccccattccgtcgccccgccccc
gccccagattggccgagtatcccggatcccgggaaagattttcgctgttatcctaggggg
atagagcgacctcctgtgctctgtggcgctgcaggttgccgaggagctcaagtagaagaa
atatggagtttagaacctgagaattttgaaaaattaaagccagttcatgggttaattttt
cttttcaagtggcagccaggagaagaaccagcaggctctgtggttcaggactccagactt
gacacgatattttttgccaagcaggtaattaataatgcttgtgctactcaagccatagta
agtgtgttactgaactgtacccatcaagatgtccatttaggagagacgttatcagaattt
aaggaattttcacaaagttttgatgcagctatgaaaggtttggcactgagcaattcggac
gtgattcggcaagtacacaacagtttcgccagacagcagatgttcgagtttgacgcaaag
acatcggcaaaagaagaagatgcttttcactttgtcagttatgttcctgttaatggaaga
ttgtatgaattagacggattgagagaaggaccgattgatttaggggcgtgcaatcaagat
gactggatcagtgcagtgaggccggtcatagaaaaaaggatacaaaagtacagtgaaggt
gaaattcgatttaacttaatggccattgtgtctgacagaaaaatgatatatgaacagaag
atagcggagttgcaaagacagcttgctgagtatgtgggctgccagcacggcacggctgct
aacagaatggaacccatggacacagatcagggtaataatatgttaagtgctattcagtca
gaagttgccaaaaaccagctacttatcgaagaagaagtgcagaagttaaaaagatataag
attgaaaatatcagaaggaagcataattatctgcctttcattatggaactgttaaagact
ttagcagaacaccagcagttaataccactagtggaaaaggcaaaagaaaaacagaatgca
aagaaagcacaggaaaccaaatga

DBGET integrated database retrieval system