KEGG   Equus caballus (horse): 100059547Help
Entry
100059547         CDS       T01058                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform X1
  KO
K05610  ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100059547 (UCHL5)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100059547 (UCHL5)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100059547 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 100059547
NCBI-ProteinID: XP_023488383
Position
30
AA seq 342 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEYVGCQHGTAANRMEEPMDTDQGNNMLSAIQSEVAKNQLLIEEEVQKLKRYKIENIR
RKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagctcaagtagaagaaatatggagtttagaacct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtggttcaggactccagacttgacacgatattttttgcc
aagcaggtaattaataatgcttgtgctactcaagccatagtaagtgtgttactgaactgt
acccatcaagatgtccatttaggagagacgttatcagaatttaaggaattttcacaaagt
tttgatgcagctatgaaaggtttggcactgagcaattcggacgtgattcggcaagtacac
aacagtttcgccagacagcagatgttcgagtttgacgcaaagacatcggcaaaagaagaa
gatgcttttcactttgtcagttatgttcctgttaatggaagattgtatgaattagacgga
ttgagagaaggaccgattgatttaggggcgtgcaatcaagatgactggatcagtgcagtg
aggccggtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaactta
atggccattgtgtctgacagaaaaatgatatatgaacagaagatagcggagttgcaaaga
cagcttgctgagtatgtgggctgccagcacggcacggctgctaacagaatggaggaaccc
atggacacagatcagggtaataatatgttaagtgctattcagtcagaagttgccaaaaac
cagctacttatcgaagaagaagtgcagaagttaaaaagatataagattgaaaatatcaga
aggaagcataattatctgcctttcattatggaactgttaaagactttagcagaacaccag
cagttaataccactagtggaaaaggcaaaagaaaaacagaatgcaaagaaagcacaggaa
accaaatga

DBGET integrated database retrieval system