KEGG   Equus caballus (horse): 100059582Help
Entry
100059582         CDS       T01058                                 

Gene name
SRD5A3
Definition
(RefSeq) polyprenol reductase
  KO
K12345  3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100059582 (SRD5A3)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100059582 (SRD5A3)
    1.3.1.94  polyprenol reductase
     100059582 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh Fijivirus_P9-2
Motif
Other DBs
NCBI-GeneID: 100059582
NCBI-ProteinID: XP_001916978
Ensembl: ENSECAG00000019405
Position
3
AA seq 318 aa AA seqDB search
MAPWAGAELAALSPLRAVWLTLAAAFLLTLLLQLVPHGLLPGCALFQDLIRYGKTKLGGP
PRPAACRAFDVPKRYFCHFYIISVLWNGFLLWHLTQSLFLGVPFPNWLHGLLRILGAAQF
QEGELALSAFLVLVFLWLHSLRRLFECFYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGGNVYVIGKNLLMQARWFHILGTMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGLHNLTWWLVVTYVFFSQALSAFLSHKFYK
SKFVSYPKHRKAFLPFLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctccctgggcgggggccgagctcgcggcgctgagcccgctgcgcgctgtgtggctg
acgctggccgccgccttcctgctgaccctgctcctgcagctcgtgccacacggcctgctc
ccgggctgcgcgctcttccaggacctgatccgttatgggaaaaccaagctcgggggcccg
ccgcgccccgccgcctgccgggcctttgatgtccccaagaggtatttttgtcacttctat
atcatctccgtgctgtggaacggcttcctgctttggcaccttacacaatctctgttcctg
ggagtgccttttccaaactggcttcatggcttgctcagaattcttggggctgcgcaattc
caggaaggtgagctggcgctgtctgcattcttggtattagtatttctgtggctacacagc
ttgcgaagactcttcgagtgcttctatgtcagtgtcttctccaatgtcatgattcacgtc
gtgcagtactgtttcggacttgtctactatgtcctcgttggcctgactgtgctgagccaa
gtgccaatggacggtgggaatgtctatgtgatagggaaaaatctcttgatgcaagcccgg
tggttccatatcctcgggacgatgatgttcatctggtcgtctgcccatcagtataagtgc
cacgtcattctcggcaatctcaggaaaaataaagcaggagtggtcatccactgtaaccac
cggatccccttcggagactggtttgaatacgtgtcttctcccaactacttagcagagctg
atgatctacgtttccatggccgtcacctttggactccacaacttaacctggtggctagtg
gtgacttatgtcttcttcagccaggccctgtctgctttcctcagccacaaattctacaaa
agcaaatttgtctcctacccgaagcataggaaagctttcctaccatttctgttttaa

DBGET integrated database retrieval system