KEGG   Equus caballus (horse): 100059737Help
Entry
100059737         CDS       T01058                                 

Definition
histone H2B type 2-F-like
Orthology
K11252  
histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100059737
  Immune diseases
   05322 Systemic lupus erythematosus
    100059737
  Substance dependence
   05034 Alcoholism
    100059737
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100059737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 146 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNIFKMKLLFLSSIQEPRFPQE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccagcaaaatctgctcctgctcccaagaagggctctaagaaggctgttacg
aaagtgcagaagaaggatggcaagaagcgcaaacgcagccgaaaggagagctattcggtt
tacgtgtataaggtgctgaagcaggtgcacccagacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggttact
aaatacaccagttcaaatattttcaagatgaagcttctgttcctgtcatctattcaggaa
ccaaggtttccccaagaataa

DBGET integrated database retrieval system