KEGG   Equus caballus (horse): 100059789Help
Entry
100059789         CDS       T01058                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 678 aa AA seqDB search
MGDSNMDASAPTSETVAEEVSLFSMMDMFLFSLIVGLLTYWFLFRKKKDEIPEFTKIQTT
TTSVKDSSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA
DLGSLSEIENSLAVFCMATYGEGDPTDNAQDFYDWLQEADVDLSGVKYAVFGLGNKTYEH
FNAMGKYVDRRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELLVHTDIDAAKVYVGEMGRLKSYETQKPPFDAKNPFLAVVTTNRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDVIMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPFEQEQLRKMASSSGEGKELYLTWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYET
KTGRINKGVATTWLRAKEPAKENGRRALVPMFVRKSQFRLPFKATTPVIMVGPGTGIAPF
IGFIQERAWLQQQGKEVGETLLYYGCRRSDEDYLYRDELAQFHRDGSLTQLNVAFSREQA
HKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFYDIVAELGTMEHAQAV
DYIKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccaacatggacgccagcgcgcccacgtctgagacagtggctgaagaagtc
tctcttttcagcatgatggacatgtttctgttctcactcattgtgggtctcctgacctac
tggttcctcttcagaaagaaaaaagatgaaatccccgagttcaccaaaattcaaacaacg
acgacctctgtgaaagacagcagcttcgtggaaaagatgaagaagacgggcaggaacatc
atcgtgttctatggctcccagacggggaccgccgaggagtttgccaaccgcctgtccaag
gacgcccaccgctatggaatgcggggcatggcagcagaccccgaagagtatgacttggcc
gacctgggcagcctttcagagatagagaactccctggcagtgttctgcatggccacctac
ggcgagggggaccccactgacaatgcccaggacttctatgactggctccaggaggcggac
gtggacctctctggagtcaagtatgcggtgttcggccttgggaacaagacctacgagcac
ttcaatgccatgggcaagtatgtggacaggcggctggagcagctcggtgcccagaggatc
tttgagctggggttgggcgacgatgacggaaacctggaggaggatttcatcacgtggcga
gagcagttctggccagccgtgtgtgaacactttggggtggaagccacaggagaggagtcc
agcattcgccagtatgagctgctggtgcacacagacatagacgcagccaaggtgtacgtg
ggtgagatgggccgcctgaagagctatgagacccagaaacccccctttgatgccaagaat
ccattcttggccgtagtcaccaccaaccggaagctgaaccagggaactgagcgccacctc
atgcacctggaattagacatctcagattccaaaatcaggtatgaatccggggaccatgtg
gccgtttacccggccaatgactctgccctggtcaaccagcttggcgagatcctgggtgcc
gacctggacgtcatcatgtccctaaacaatctcgatgaggagtccaacaagaaacacccg
ttcccctgccccacctcctaccggacggccctcacctactatctggatatcaccaacccg
ccgcgcaccaacgtgctctacgagctggcccagtacgcctcggagcccttcgagcaggag
cagttgcgcaaaatggcctcctcctcaggcgagggcaaggagttgtacttgacctgggtc
gtggaggcccggaggcacatcctggccatcctgcaggactacccgtccctgcggcccccc
atcgaccacctttgtgagctgctgcctcggctccaggcccgctactactccatcgcctcg
tcctccaaggtccaccccaactccgtgcacatttgtgccgtggctgtggagtatgaaacc
aagactggccgcatcaacaaaggtgtggccaccacctggctgcgggccaaggagcccgcc
aaggagaatggccgccgggccctggtgcccatgtttgtgcgcaagtcccagttccgcctg
ccattcaaggccaccacgcccgtcatcatggtgggccctggcactgggattgcccccttc
ataggcttcatccaggagcgggcctggctgcagcagcagggcaaggaggtgggggagacg
ctgctctactacggctgccgccggtcggatgaggactacctgtaccgcgacgagctggcc
cagttccacagggacggctccctcacccagctcaacgtggccttctcccgggagcaggcc
cacaaggtctatgtgcagcacttactgaaaagggacaaggagcacctgtggaagctgatc
catgagggaggcgcccacatctacgtctgcggggatgctcggaacatggcgagggatgtg
cagaacacgttctacgacatcgtggccgagctggggaccatggagcatgcccaggctgtg
gactacatcaagaagctgatgaccaagggccgctactcgctggacgtgtggagctag

DBGET integrated database retrieval system