KEGG   Equus caballus (horse): 100060068Help
Entry
100060068         CDS       T01058                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100060068 (USP5)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100060068 (USP5)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100060068 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 867 aa AA seqDB search
MGPMGSGLACPGGVGDWERWEPLCVEKLLPVSWRKLSEEALLSVLPTIRVPKAGDRVHKD
ECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVYLHLRRTRRPKEEDTATGT
GDPPRKKPTRLAIGVEGGFDLSEEKFEYDEDVKIVILPDYLEIARDGLGGLPDIVRDRVT
SAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENL
WLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVL
DPNLAEHLSHFGIDMLKMQKTDKTMTELEIDMNQRIGEWELIQESSVPLKPLFGPGYTGI
RNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGE
YSKPAAESGDGEQVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVE
RNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPVPMDAALNKEELLEYEEK
KRQAEEEKLPLPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFASFPDY
LVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEPK
APMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSS
GPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAA
MDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVI
YNDQKVCASEKPPKDLGYIYFYQRVAS
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggggccaatgggcagcggcttggcttgcccggggggggtgggggactgggaacggtgg
gagccgctgtgtgtggagaagctgctgccggtgtcatggcggaaactgagtgaggaggcg
ctgctgtcagtgttaccgacgatccgggtccctaaggctggagaccgggtccacaaagac
gagtgcgccttctctttcgacacgccggagtctgagggtggcctctacatctgcatgaac
acattcctgggcttcgggaaacagtatgtagaaagacacttcaacaagacgggccagcga
gtctacctgcacctccgtcggacccggcgcccgaaagaggaagacaccgccacaggcact
ggagaccccccccgtaagaagcccacccggctggctattggtgttgaaggcgggtttgac
ctcagcgaggagaagtttgagtatgatgaggatgtgaagattgtcattttgccagattac
ctggagattgcccgggatgggttggggggactgcctgacattgtcagagatcgggtgacc
agtgcagtggaggccctattgtcggccgactcagcctcccgcaagcaggaggtgcaggcc
tgggatggggaagtgcggcaggtgtctaagcatgccttcagcctcaagcagctggacaac
cctgctcgaatccctccctgtggttggaagtgctccaagtgtgacatgagagagaacctg
tggctcaacctgacagatggctccatcctctgtggccgacgctactttgatggcagtggg
ggcaacaaccacgccgtggagcactacagggagacaggctacccgttagctgtcaagctg
ggcaccatcacacctgatggagctgatgtgtactcatatgatgaggatgacatggtcctg
gaccccaacctggccgagcatctgtcccactttggcattgatatgctgaagatgcagaag
acggacaagacgatgacagagttggagatagatatgaaccagcggattggtgaatgggag
ctgatccaggagtcgagcgtgccactgaagcccctgtttgggcctggctatacaggcatc
cggaacctgggtaacagctgctacctcaactcggtggtccaggtgctcttcagcatccct
gacttccagaggaagtatgtggataagctggagaagatcttccagaatgccccaacggac
cctacccaggacttcagcacccaggtggccaagctgggccatggccttctctcgggagag
tattccaagccagcagcggagtcgggtgatggggagcaggtaccagaacaaaaggaagtt
caagatggcattgcccctcggatgttcaaggccctcattggcaagggtcaccctgagttc
tccaccaaccggcaacaggatgcccaagagttcttccttcacctcatcaacatggtggag
aggaattgccggagctctgaaaatcctaatgaagtgttccgcttcttggtggaggaaaag
atcaagtgcctggccacagagaaggtgaagtacacccagcgagtggactacatcatgcag
ctgcctgtgcccatggatgcagcccttaacaaagaggagcttctggagtatgaggagaag
aagcggcaagctgaagaggagaagctgccactgccagaactggttcgggcccaggtgccc
ttcagctcctgcctggaggcctatggggcccccgagcaggtggatgacttctggagcacg
gccctgcaggccaagtctgtagctgtcaagaccacacgatttgcctcattccctgactac
ctggtcatccagatcaagaaattcaccttcggcttagactgggtgcccaagaaactggat
gtgtccattgagatgccagaggagctggacatctcccagttgaggggtacagggctgcag
cctggagaggaggagctgcctgacattgccccacccctggtcactccggatgagcccaaa
gcacccatgttggacgaatccgtcatcatccagctggtggagatgggcttccctatggat
gcctgccgcaaagctgtctactacacaggcaacagtggggctgaggctgccatgaactgg
gtcatgtcgcacatggatgatccagattttgcaaaccccctcatcctgcctggctccagt
gggcctggctccacaagtgcagcagctgacccccctccagaggactgtgtcaccactatt
gtctccatgggcttctctcgggaccaggccctcaaagctctgcgggccacgaacaatagt
ttagaacgggctgtggactggatcttcagtcacattgatgacctcgatgcagaagctgct
atggacatctcggagggccgctcagctgctgactccatctctgagtctgtgccagtggga
cctaaagtccgggatggtcctggaaagtatcagctctttgccttcattagtcacatgggc
acctctaccatgtgtggtcactatgtctgccacatcaagaaggaaggcagatgggtgatc
tacaatgaccagaaagtgtgtgcctctgagaagccgcccaaggacctgggctacatctac
ttctatcagcgagtggccagctaa

DBGET integrated database retrieval system