KEGG   Equus caballus (horse): 100060335Help
Entry
100060335         CDS       T01058                                 

Gene name
HSD17B10
Definition
hydroxysteroid (17-beta) dehydrogenase 10
Orthology
K08683  
3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
ecb  Equus caballus (horse)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100060335 (HSD17B10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100060335 (HSD17B10)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100060335 (HSD17B10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     100060335 (HSD17B10)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    100060335 (HSD17B10)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100060335 (HSD17B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 261 aa AA seqDB search
MAAASRSVKGLVAVITGGASGLGLATAERLVGQGATAVLLDLPNSDGETQAKKLGKSCAF
APADVTSEKDVQAALTLAKEKFGRVDVAVNCAGIAVAIKTYNLKKSRAHTLDDFQRVLNV
NLVGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPMGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAI
IENPFINGEVIRLDGAIRMQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcgagtcggagtgtgaagggcctggttgccgtcataaccggaggagcctcg
ggcttaggcctggccacggcggagcgactggtggggcagggggccactgctgtgcttcta
gacctgcccaactcggatggggagacccaggccaagaagttagggaagagctgcgccttc
gccccagccgacgtgacctcagagaaggacgtgcaagcagccctgactctagcaaaagaa
aagtttggccgtgtggatgtggcagtcaactgtgcaggcattgcagtggccatcaagaca
tacaacttaaagaagagccgggcccataccttggatgacttccagcgagttctcaatgtg
aatctcgtaggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagatcagggaggccagcgtggagttatcatcaacactgccagcgtggctgcctttgag
ggccaggttggacaagctgcatactctgcttccaaggggggcatagtgggcatgacactg
cccattgctcgggatctggcgcccatgggcatccgggtgatgaccattgctccaggccta
tttggcaccccactgctgaccagcctcccagagaaagtgcgcaacttcctggccagccag
gtgcccttcccgagccgactgggcgaccctgctgagtatgctcatctggtacaggccatc
attgagaacccattcatcaatggagaggtcatccggctggatggggccatccgcatgcag
ccttaa

DBGET integrated database retrieval system