KEGG   Equus caballus (horse): 100060335Help
Entry
100060335         CDS       T01058                                 

Gene name
HSD17B10
Definition
hydroxysteroid (17-beta) dehydrogenase 10
Orthology
K08683  
3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
ecb  Equus caballus (horse)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Alzheimer's disease
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ecb00280]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ecb05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 261 aa AA seqDB search
MAAASRSVKGLVAVITGGASGLGLATAERLVGQGATAVLLDLPNSDGETQAKKLGKSCAF
APADVTSEKDVQAALTLAKEKFGRVDVAVNCAGIAVAIKTYNLKKSRAHTLDDFQRVLNV
NLVGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPMGIRVMTIAPGLFGTPLLTSLPEKVRNFLASQVPFPSRLGDPAEYAHLVQAI
IENPFINGEVIRLDGAIRMQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcgagtcggagtgtgaagggcctggttgccgtcataaccggaggagcctcg
ggcttaggcctggccacggcggagcgactggtggggcagggggccactgctgtgcttcta
gacctgcccaactcggatggggagacccaggccaagaagttagggaagagctgcgccttc
gccccagccgacgtgacctcagagaaggacgtgcaagcagccctgactctagcaaaagaa
aagtttggccgtgtggatgtggcagtcaactgtgcaggcattgcagtggccatcaagaca
tacaacttaaagaagagccgggcccataccttggatgacttccagcgagttctcaatgtg
aatctcgtaggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagatcagggaggccagcgtggagttatcatcaacactgccagcgtggctgcctttgag
ggccaggttggacaagctgcatactctgcttccaaggggggcatagtgggcatgacactg
cccattgctcgggatctggcgcccatgggcatccgggtgatgaccattgctccaggccta
tttggcaccccactgctgaccagcctcccagagaaagtgcgcaacttcctggccagccag
gtgcccttcccgagccgactgggcgaccctgctgagtatgctcatctggtacaggccatc
attgagaacccattcatcaatggagaggtcatccggctggatggggccatccgcatgcag
ccttaa

DBGET integrated database retrieval system