KEGG   Equus caballus (horse): 100060370Help
Entry
100060370         CDS       T01058                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
ecb  Equus caballus (horse)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100060370 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100060370 (GLA)
   00600 Sphingolipid metabolism
    100060370 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100060370 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100060370 (GLA)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100060370 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 433 aa AA seqDB search
MTGTMNLRSRAQLLGCVLGLRSLALVLWGIPGARALDNGLAMTPTMGWLHWERFMCNTDC
EEDPDSCVSEKLFMQMADLMDSEGWRDVGYEYLCIDDCWMAPQRDSKGRLQADPKRFPGG
IRRLADYVHGKGLKLGIYADVGKLTCAGFPGSYGYYDIDAKTFADWGVDLLKFDGCHFDT
LVDLADGYKYMSLALNRTGRSIVYSCEWPLYMMPFRKPNYTEVREYCNHWRNFADIYDAW
QSVKSVLDWTSSNQEKIVDAAGPGGWNDPDMLVIGNFGLSWDQQITQMALWAIMAAPLFM
SNDLRQISPQAKALLQDKDVIAINQDPLGKQGYRLRKEDNIEVWERPLSDFAWAVAMVNL
QEIGGPRFHTISLASLGGGLACLPACLITELLPVKGKLGFYEWTSSLKLRINPTGTVLLR
LDRTNXMAXESFL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagggacgatgaacctgaggagcagagcccagctgctgggctgcgtgctggggctc
cgctccctggccctggtactctggggcatccctggggccagggccctggacaatggcttg
gcgatgacccctaccatgggctggctgcactgggagcgatttatgtgcaacactgactgt
gaagaagacccggattcctgtgtcagtgagaagctcttcatgcagatggcagacctcatg
gactcagaaggctggagggatgtaggttatgagtacctctgcattgatgactgttggatg
gctccccaaagagattcaaaaggcagacttcaggcagaccctaaacgctttcctggtggg
atccgccgcctagctgattatgtccatggcaaaggactgaagctaggaatttatgcagat
gttggaaagctaacctgtgcaggcttccctgggagttatggatactatgacattgatgcg
aagacctttgctgactggggagtagatctgctgaaatttgatggttgtcactttgacact
ttggtagatttggcagatggttataagtacatgtccttggccctgaacaggactggcaga
agcattgtgtactcctgtgagtggcccctttatatgatgccctttcgtaagcccaattac
acagaagtccgagagtactgcaatcactggagaaattttgctgacatttatgatgcttgg
caaagtgtaaagagtgtcttggactggacgtcttctaaccaggagaaaattgttgatgcc
gcaggaccagggggttggaatgacccagacatgttagtgattggcaactttggcctcagc
tgggatcagcaaataactcagatggccctctgggctatcatggcagctccattatttatg
tccaatgacctccgacagatcagccctcaagccaaagcactccttcaagataaggatgta
attgccatcaaccaggaccccctgggcaagcaggggtaccggcttagaaaggaagacaac
attgaggtgtgggaacgccctctctcggactttgcctgggctgtggcgatggtaaacctg
caggagattggtggacctcgttttcataccatctctcttgcttccctgggtggaggactg
gcctgtcttcctgcctgcctgatcacagagctccttcctgtgaagggaaagcttgggttt
tatgaatggacttcaagtttaaaactgcgaataaatcccacaggcactgttttgcttcgg
ctagacagaacaaactagatggcataagaaagcttcctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system