KEGG   Equus caballus (horse): 100060432Help
Entry
100060432         CDS       T01058                                 

Gene name
USP46
Definition
(RefSeq) ubiquitin specific peptidase 46
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100060432 (USP46)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100060432 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 360 aa AA seqDB search
MATDKRGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAY
KAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLN
YLLNTIADILQEEKKQEKQNGKLKNGNMNETAENNKPELTWVHEIFQGTLTNETRCLNCE
TVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKK
LPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVAVVVHCG
SGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctactgacaagcgaggcaccaatgcctctgctctggaaaaagacattggtccagag
cagtttccgatcaatgaacactactttggattggtcaacttcggaaacacttgctactgt
aactccgtgcttcaggccttgtacttctgccggccgttccgggagaatgtgttggcatat
aaagcccagcaaaaaaagaaggaaaacttgttgacgtgcctggcagaccttttccacagc
attgccacgcagaagaagaaggttggcgtgatcccaccaaagaagttcatttcgaggctg
aggaaagagaatgatctctttgataactacatgcagcaggatgctcacgaatttttaaat
tatttgctaaacactattgcggacatcctgcaggaagagaagaaacaggaaaaacaaaac
ggaaaattaaaaaatggcaacatgaacgaaactgcggagaataataagccagaactcacc
tgggtccatgagatatttcagggaacgctcaccaatgaaactcggtgcttgaactgtgaa
actgttagtagcaaagatgaagattttcttgacctttctgtggatgtggagcagaataca
tctattacccactgtctaagagacttcagcaacacggaaacactgtgtagtgaacagaag
tattattgtgaaacgtgctgcagcaaacaggaggcccagaagaggatgagagtcaaaaag
ctgcccatgattttggccctgcacctaaagcggttcaagtacatggagcagctgcacagg
tacaccaagctgtcctaccgagtggtcttccccctggaactccggctcttcaacacctcc
agcgatgcggtgaacctggaccgcatgtacgacctggtcgcggtggtggttcactgcggc
agtggtccaaatcgtgggcattatattactattgtgaaaagtcatggcttctggcttctg
tttgatgatgacattgtagagaaaatagatgcccaagctattgaagaattctatggcctg
acatcagatatatcaaaaaattcagaatctggatatattttattctatcagtcaagagaa
taa

DBGET integrated database retrieval system