KEGG   Equus caballus (horse): 100060485Help
Entry
100060485         CDS       T01058                                 

Gene name
SCD
Definition
(RefSeq) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01212  Fatty acid metabolism
ecb03320  PPAR signaling pathway
ecb04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100060485 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100060485 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100060485 (SCD)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100060485 (SCD)
Lipid biosynthesis proteins [BR:ecb01004]
 Desaturase
  First
   100060485 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 100060485
NCBI-ProteinID: XP_001500414
Ensembl: ENSECAG00000014658
UniProt: F7DN83
Position
1
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTSPYLEEDIRPEMKEDLYDPSYR
DKEGPKPKFQYVWRNIILMSLLHVGALYGILLFPSCKIYTYLWVAFYYFTSALGVTAGAH
RLWSHRTYKARLPLRLFLIIANTMAFQNDIFEWARDHRVHHKFSETDADPHNARRGFFFS
HVGWLLVRKHPAVKEKGALLELSDLKAEKLVMFQRRYYKPGVVLLCFILPTLVPWYFWGE
TFPHSLFVATLLRYALVLNVTWLVNSAAHLYGYRPYDKTINPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAVLGLAYDRKKVSKAAILAKIKRTGDETYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccatttgctgcaagaggagatctctagctcctacactaccaccaccaccatc
acagcgcctccctccagggtcctgcagaatggaggaggcaagttggagaagacttcccca
tacttggaagaagacatccgccctgaaatgaaagaagacctctatgacccgagctaccgg
gataaggagggcccaaagcccaagtttcagtatgtttggagaaacatcatccttatgtct
ctgctacacgtgggagccctgtatgggatcctactgttccccagctgcaagatctacacc
tacctctgggtggctttctactatttcaccagtgcccttggcgtaacggcaggagcgcat
cgcctgtggagccaccggacttacaaagctcggctgcccctgcgtctcttcctgatcatt
gccaacacgatggccttccagaatgacatttttgaatgggcccgagatcaccgtgtccac
cacaagttttcagaaacagatgctgatccccacaatgcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagcagtcaaagagaaaggtgctttgcta
gagttatctgacctaaaagccgagaagctggtgatgttccagaggaggtactacaaaccc
ggtgtcgtgttgctgtgcttcatcctgcccacacttgtgccctggtatttctggggtgaa
acttttccacacagcttatttgtcgccactttgttgcgttacgctcttgtgctcaatgtc
acttggctggtgaacagtgctgcccacctctacggatatcgtccttacgacaagaccatt
aacccccgagagaatatcctggtttcactgggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaactttacc
acattcttcatcgattgcatggctgtcctcggtttggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaagattaaaagaactggagatgaaacctacaagagtggctga

DBGET integrated database retrieval system