KEGG   Equus caballus (horse): 100060694Help
Entry
100060694         CDS       T01058                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 250 aa AA seqDB search
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagatgcccatgaattcttaaattacctactaaatacgattgctgatatttta
caagaagagagaaagcaggaaaaacaaaatggccgtttacctaatggtaatattgacagt
gagaataacaacagcacaccagacccaacttgggttcatgagatttttcagggaacatta
actaatgaaaccagatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcaattactcactgcttaaggggttttagc
aacacagaaactctatgcagtgaatacaaatattactgtgaagaatgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctgcacctgaaa
agatttaagtatatggatcaacttcatcgatatacaaaactttcttaccgggtagttttt
cctttagaacttcgtctatttaacacttcaggcgatgcaaccaatcctgacagaatgtac
gaccttgtcgccgttgtggttcactgtggaagtggtcccaatcgaggccattatattgca
atagttaagagtcacgatttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttaacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system