KEGG   Equus caballus (horse): 100060775Help
Entry
100060775         CDS       T01058                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 615 aa AA seqDB search
MARATEPERRLLAVYTGGTIGMRSERGVLIPGRGLADVLRTLPMFHDEEHARACDLPEDT
LVLPPASPEQRVIYTVLECQPLFDSSDMTITEWVQIAQIIERHYEQYHGFVVIHGTDTMA
FAASVLSFVLENLQKTVVLTGAQVPIHALWNDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRVTKVDARRFAAFCSPNLPPLAIVGPDVTINQELVRKVRGMERLVVHSSMEHDVGL
LRLYPGIPAALVGAYLPALSTPLRLPHPLWLPSACTSQFDPHPLPSPPCPDYRHANHGLR
HLKGDRASDPLGRCGGELSMWTVDILGRQWVPRGASGCACVNCTHCLXGGVTSDYAAGMA
MAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLEGRKELLARDLRGEMTLPAVDERRPSLQ
RSVLGHGVAQLLRQSQGADAVRDTLMPSLACAGARAGDLEALQALVELGSDLSLEDCSGQ
TPLHAAARGGHVEVLAMLLQRGVNVNARDQDGLTPLLLAVRGRHQGVIELLRAAGACLSP
EELEDTGTELCRLASRGDCEGLRAWWQAGADLGRPGYDGRSALLIAEAAGDLEVVTVLQS
LQGGVGAQALGPATP
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcgacggagcccgagcggcggctcctggccgtctacaccggcggcaccatc
ggaatgcggagcgagcgtggcgtgctcatcccagggaggggcctggccgatgtcctgagg
acactgcccatgttccacgatgaggagcacgcccgggcctgtgacctccctgaggacacc
ctggtgctgccgcccgccagcccagaacagagggtcatctacacagtgctggagtgccag
cccctcttcgactccagtgacatgaccatcactgagtgggttcagattgcccagatcatt
gagagacactatgagcagtaccatggctttgtggtcatccacggcaccgacaccatggcc
ttcgctgcgtccgtgctctcctttgtgctggaaaacctgcagaaaacagtcgtcctcact
ggtgcccaggtgcccatccatgccctgtggaacgacggccgcgagaacctgctgggggcc
ctgctcatggccggccagtacgtgatccctgaggtctgcctgttcttccagaatcagctg
tttcggggcaaccgagtgaccaaggtggacgcgcgtaggttcgcggccttctgctcccca
aacctgcctcctctggccatcgtgggccctgatgtcacaatcaaccaggagctggtgcgc
aaggtccgagggatggagaggctggtggtgcacagcagcatggagcatgacgtgggcctg
ctgcgtctctaccccgggatccccgctgccctggtaggtgcatacctgccagccctcagc
acccctctgcggctcccacaccccctgtggctccccagtgcctgcaccagccagttcgac
ccccaccctctgccttcccctccttgtcctgattatcgccacgccaaccatggcctcaga
cacttgaaaggggacagggcgtcggaccctttgggaagatgtggtggggagctctccatg
tggaccgtggacatcctgggaaggcagtgggtgccccgtggtgcttctggctgcgcctgc
gtcaactgcacccactgcctgncaggcggcgtgacatcggactatgcagccggcatggcc
atggcgggagccggcatagtctcaggctttgacatgacgtcggaggctgctctggccaag
ctgtcctatgtgctgggccagccggggctgagcctggagggcaggaaggagctgctggcc
agggacctccggggggagatgacgctgcccgcggtggatgagcgccggccctctctgcag
cgcagtgtgctggggcatggggtcgcccagctccttcgtcagagccagggggccgatgct
gtgcgggacaccctcatgcccagcctggcctgtgctggggcccgtgccggcgacctggag
gccctgcaggcgctggtggagctgggcagtgacctaagcctggaggactgcagtggtcaa
actccactgcacgcagctgcccgtgggggccacgtggaggtgctcgccatgctgctgcag
agaggggtgaacgtcaacgcccgggaccaggacggcctcactcccctgctgctggctgtg
aggggcaggcatcagggtgtcatcgagctgctgcgggcagctggggcctgtctgtccccc
gaggagctggaggacacagggactgagctgtgcaggttggcatccaggggggactgcgaa
ggcctaagggcgtggtggcaggcaggggcagacctgggacggccaggctatgacgggcgc
agcgccttgctcattgcggaagcagctggggacctggaagtggtgacggttctgcagagc
ctccagggtggggttggtgcccaggccctgggtccagccaccccgtga

DBGET integrated database retrieval system