KEGG   Equus caballus (horse): 100060775Help
Entry
100060775         CDS       T01058                                 

Gene name
ASPG
Definition
(RefSeq) asparaginase
  KO
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100060775 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     100060775 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     100060775 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
24
AA seq 724 aa AA seqDB search
MARATEPERRLLAVYTGGTIGMRSERGVLIPGRGLADVLRTLPMFHDEEHARACDLPEDT
LVLPPASPEQRVIYTVLECQPLFDSSDMTITEWVQIAQIIERHYEQYHGFVVIHGTDTMA
FAASVLSFVLENLQKTVVLTGAQVPIHALWNDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRVTKVDARRFAAFCSPNLPPLAIVGPDVTINQELVRKVRGMERLVVHSSMEHDVGL
LRLYPGIPAALVGAYLPALSTPLRLPHPLWLPSACTSQFDPHPLPSPPVSSCTCPSFHHP
RPASGFGAQSHRICAMCLSLQRPWTHDACTGSSSGADGPPAVIEAATAPASVLPCQLDSE
AMQPIGWRISELEVPLGCARAGEGVMLALEAPPGCRECPDYRHANHGLRHLKGDRASDPL
GRCGGELSMWTVDILGRQWVPRGASGCACVNCTHCLXGGVTSDYAAGMAMAGAGIVSGFD
MTSEAALAKLSYVLGQPGLSLEGRKELLARDLRGEMTLPAVDERRPSLQRSVLGHGVAQL
LRQSQGADAVRDTLMPSLACAGARAGDLEALQALVELGSDLSLEDCSGQTPLHAAARGGH
VEVLAMLLQRGVNVNARDQDGLTPLLLAVRGRHQGVIELLRAAGACLSPEELEDTGTELC
RLASRGDCEGLRAWWQAGADLGRPGYDGRSALLIAEAAGDLEVVTVLQSLQGGVGAQALG
PATP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcgacggagcccgagcggcggctcctggccgtctacaccggcggcaccatc
ggaatgcggagcgagcgtggcgtgctcatcccagggaggggcctggccgatgtcctgagg
acactgcccatgttccacgatgaggagcacgcccgggcctgtgacctccctgaggacacc
ctggtgctgccgcccgccagcccagaacagagggtcatctacacagtgctggagtgccag
cccctcttcgactccagtgacatgaccatcactgagtgggttcagattgcccagatcatt
gagagacactatgagcagtaccatggctttgtggtcatccacggcaccgacaccatggcc
ttcgctgcgtccgtgctctcctttgtgctggaaaacctgcagaaaacagtcgtcctcact
ggtgcccaggtgcccatccatgccctgtggaacgacggccgcgagaacctgctgggggcc
ctgctcatggccggccagtacgtgatccctgaggtctgcctgttcttccagaatcagctg
tttcggggcaaccgagtgaccaaggtggacgcgcgtaggttcgcggccttctgctcccca
aacctgcctcctctggccatcgtgggccctgatgtcacaatcaaccaggagctggtgcgc
aaggtccgagggatggagaggctggtggtgcacagcagcatggagcatgacgtgggcctg
ctgcgtctctaccccgggatccccgctgccctggtaggtgcatacctgccagccctcagc
acccctctgcggctcccacaccccctgtggctccccagtgcctgcaccagccagttcgac
ccccaccctctgccttcccctcctgtctcctcctgcacttgtccttccttccatcaccca
aggcccgcctcaggcttcggggcccagtctcaccgtatttgcgccatgtgcttgtccttg
caacgcccgtggactcacgacgcctgcaccggcagttcctctggggctgacgggccacca
gctgtcattgaggcagccacagcgcctgcctctgtcctgccttgccagttggactcagag
gccatgcagcccattggatggaggatctctgagctagaggtgcctctgggctgtgctaga
gcaggcgagggggtcatgctggccttggaggcaccgccaggctgcagagagtgtcctgat
tatcgccacgccaaccatggcctcagacacttgaaaggggacagggcgtcggaccctttg
ggaagatgtggtggggagctctccatgtggaccgtggacatcctgggaaggcagtgggtg
ccccgtggtgcttctggctgcgcctgcgtcaactgcacccactgcctgncaggcggcgtg
acatcggactatgcagccggcatggccatggcgggagccggcatagtctcaggctttgac
atgacgtcggaggctgctctggccaagctgtcctatgtgctgggccagccggggctgagc
ctggagggcaggaaggagctgctggccagggacctccggggggagatgacgctgcccgcg
gtggatgagcgccggccctctctgcagcgcagtgtgctggggcatggggtcgcccagctc
cttcgtcagagccagggggccgatgctgtgcgggacaccctcatgcccagcctggcctgt
gctggggcccgtgccggcgacctggaggccctgcaggcgctggtggagctgggcagtgac
ctaagcctggaggactgcagtggtcaaactccactgcacgcagctgcccgtgggggccac
gtggaggtgctcgccatgctgctgcagagaggggtgaacgtcaacgcccgggaccaggac
ggcctcactcccctgctgctggctgtgaggggcaggcatcagggtgtcatcgagctgctg
cgggcagctggggcctgtctgtcccccgaggagctggaggacacagggactgagctgtgc
aggttggcatccaggggggactgcgaaggcctaagggcgtggtggcaggcaggggcagac
ctgggacggccaggctatgacgggcgcagcgccttgctcattgcggaagcagctggggac
ctggaagtggtgacggttctgcagagcctccagggtggggttggtgcccaggccctgggt
ccagccaccccgtga

DBGET integrated database retrieval system