KEGG   Equus caballus (horse): 100060789Help
Entry
100060789         CDS       T01058                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100060789 (PBK)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100060789 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 324 aa AA seqDB search
MEEVSNFKTPSKLSEKKKSGLSLTPCINIPASPFMQKLGFGTGVNVYLMKRSPRGLSYSP
WAVKKINPRCNDDYQSMYLKRLTDEAKILKSLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERNKDSRDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGVITDKADIFAFGLTLWEM
MTLSIPHINLPDDDDDDEDKTFDESDFDDEAYYAALGTRPPVNMEELDETYQKVIELFSV
CTNEDPKDRPSAAHIVEALEMDVQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtcagtaatttcaagacaccaagcaaactatctgaaaagaagaaatctgga
ttatctttaactccatgtataaatattcctgcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtctaccttatgaaaagatctccaagaggtttatcttattctcct
tgggctgtgaaaaaaattaatcctagatgtaatgatgattatcaaagtatgtatctaaag
agactaactgacgaagctaagattttgaaaagccttcatcatccaaacattgtaggttat
cgggctttcactgaagccagtgatggtagtctctgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgaaataaagacagccgagatccttttccagca
gccataatattaaaagttgctttgaacatggcaagggggttaaagtatctgcaccaagaa
aagaaactgcttcatggagacataaaatcttcaaatgttgtaattaaaggtgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccccgaggcctgttacattggcactgagccttggaaacccaaggaagctctggaggag
aatggtgttattaccgacaaggcagacatatttgcctttggccttacgctgtgggaaatg
atgactttatctattccacacattaatcttccagatgatgatgatgatgatgaagataaa
acttttgatgaaagtgactttgatgatgaagcatactatgcagctttgggaaccaggcca
cctgttaacatggaagaactggatgaaacgtaccagaaagtaattgaactcttctctgta
tgcaccaatgaagatcctaaagatcgtccttctgctgcacacatcgttgaagctttggaa
atggatgtccagtga

DBGET integrated database retrieval system