KEGG   Equus caballus (horse): 100060791Help
Entry
100060791         CDS       T01058                                 

Gene name
PDK3
Definition
pyruvate dehydrogenase kinase, isozyme 3
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100060791 (PDK3)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100060791 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 360 aa AA seqDB search
MFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLD
NFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLIN
QHTLLFGGDTNPAHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAK
APDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPSVKTLVTLGKEDLSIKIS
DLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYS
MEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSREPRDASKYKAKQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttctacgaaaggagcttcctgtacgactggctaacacaatgagagaagttaatctt
ctgccggataatttgcttaaccgcccttcagtaggattggttcagagttggtacatgcag
agctttcttgagcttttagaatatgaaaacaaaagccctgaggatccacaggtcttggat
aactttctgcaagttctgattaaagtcagaaatagacacaatgatgtggttcctacaatg
gctcaaggagtgattgaatacaaggagaagtttgggtttgatccgttcattagcagtaac
atccagtattttctagatcgattttataccaaccgcatctctttccgcatgcttattaac
cagcacacactgctctttggtggcgacactaaccctgctcatccgaagcacataggaagt
attgatcccacctgcaatgtggctgacgtggtgaaagatgcgtatgagaccgccaagatg
ctgtgcgagcagtactacctggtggctccagagctggaagttgaggaatttaacgccaaa
gctccagacaagcctatccaggtcgtgtatgtgccctcccatctgtttcacatgctgttt
gagttgttcaagaattcaatgagagcaacagtcgaactatatgaagatcgaaaagagggc
tacccgtccgttaaaacccttgttactctgggtaaagaagacttgtccattaagataagt
gacttaggtggtggggtcccacttcgaaaaatagatcgtctttttaactacatgtattcg
actgcccctagacctagcctggagcctacgagagctgcccctttggctggatttggttat
ggtttgccaatttctcgtctgtatgctagatattttcaaggagatctaaaactctattcc
atggaaggagtgggtactgatgctgttatttatttgaaggctctttcaagtgaatcattt
gagagacttccggtttttaataagtccgcatggcgccattacaagaccacacctgaagcc
gacgattggagcaatcccagcagagaacccagagatgcttcaaaatataaggcgaaacag
taa

DBGET integrated database retrieval system