KEGG   Equus caballus (horse): 100060968Help
Entry
100060968         CDS       T01058                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ecb  Equus caballus (horse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100060968 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100060968 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100060968 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100060968 (SCD5)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100060968 (SCD5)
Lipid biosynthesis proteins [BR:ecb01004]
 Desaturase
  First
   100060968 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 447 aa AA seqDB search
MRPLSNLDSQPRGRLHPLLPPPLPFPWSKTGLCVPLRPLPGGRSVSPLHTPAPDPPARCQ
DIKGSSWPRPGGQLHHQREPLGGDCEQDLEFTGKGSLSRRSLSSYRGPAGARGSAEGQRL
GSWERAQRSLDLAFSVGKLRACDQMAYKRECSSQGSGFSALLVRWNHLWREMPALPALVS
DSIRPGALALFKNAAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQND
IFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADP
VVRFQRKYYKVTVVLMCFLVPTLVPWYLWGESLWNSYFLASILRYTISLNVTWLVNSAAH
MYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDFMCW
LGLATDRKRATKPMIEARKARTGDGSA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagacctctctcaaatctggacagtcagccccgcgggagacttcacccgctgcttccc
ccacctctccccttcccttggtcgaagacaggtctctgcgtgcctctgcgacctctcccc
gggggtcgcagcgtgagcccgctgcacacacctgcccccgaccccccagcccggtgccag
gatatcaaaggctccagctggccacggcctggggggcagctgcaccatcaaagggagccg
ctgggaggggactgcgaacaggacctggagttcacaggaaagggtagcctgagccggaga
tcacttagcagttaccgaggccccgcgggtgccaggggctccgcagagggtcagcgcctg
ggaagctgggagagagcgcagcgctctctggatctcgctttctccgttggtaaattgagg
gcatgcgaccagatggcctataagagagagtgtagctcacagggcagcggtttctcagcc
ctgcttgtgcgttggaatcacctgtggagagagatgccggctctccccgccctcgtctct
gattcgatccgccctggggccctagcgctgtttaaaaacgcagcctacttctgcttcctc
ctgacggctctgggtgtgacagctggtgcccatcgcttgtggagccacaggtcctacaag
gccaagctgcctctgaggatatttctggctgccgccaactccatggctttccagaacgac
atcttcgaatggtccagggatcaccgagtccaccataagtactcagagaccgacgctgac
ccccacaacgcccgccgcggcttcttcttctcccatatcgggtggctgtttgttcgcaag
catcgagatgtcatcgagaaggggagaaagcttgacgtcactgacctgctggctgatcct
gtggtccggttccaaaggaagtactataaggtcaccgtggtgctcatgtgcttcctggtg
cccacgctggtaccctggtacctctggggagagagtctctggaattcctacttcctggcc
tccatccttcgctataccatctcactcaacgtcacctggctggtcaacagtgccgcccac
atgtatggaaaccggccctatgacaagcacatcagccctcggcagaacccactggtcact
cttggcgccattggtgaaggcttccacaactaccatcacacctttccctttgactactct
gcgagtgaatttggcctaaatttcaacccaaccacctggttcattgacttcatgtgctgg
ctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcgcggaaagcc
aggactggagatggcagcgcctga

DBGET integrated database retrieval system