KEGG   Equus caballus (horse): 100061108Help
Entry
100061108         CDS       T01058                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ecb  Equus caballus (horse)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ecb00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 905 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFPRWR
TKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIINAPCHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSSLYNRFLFPEGVKGMVQAV
RLIAEGRAPRLPQPEEGATYEGIQKKETAKINWEQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTVGLVPEGEALPIPGAHRPGLVTKDGLVLFGNDDRMLLVKNIQLEDGKMI
LASHFFKGADSSVLELTEAELVTAEAVRSAWKRILPNILEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFRDFIQLLVRKLRGDDKESECVIDYVEKEANRLTIKM
PHQLFIGGAFVDAEGDKTYETINPTDGSAICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QVGAGSCSPRESSHRRAGLVMNSKKPVQVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIK
PAQVTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKH
IMKSCALSNVKKVSLELGGKSPLIIFADCDLSKAVQMGMSSVFFNKGENCIAAGRLFVED
SIHDQFVQKVVEEVRKMKIGNPLDRDTTHGPQNHQAHLRKLIEYCQRGVKEGATLVCGGN
QVPRPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFANGDVDTVLSRANATEFGLASG
VFTKDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKT
VTFEY
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcggtgatcgggcagagcctgtttggccaggaagtatactgccacctgagg
aaggagggccatgaggtcgtgggcgtgttcactgtcccagacaaggatgggaaggcagat
cctctgggcctagaggccgagaaggatggtgtgccagtgttcaagtttccccgctggcgg
acgaaaggacaggctctgcccgacgtcgtggccaaataccaggctttgggtgccgagctc
aacgtcctgcccttctgcagccagttcatccccatggagatcatcaacgcgccctgccac
ggctccatcatctaccacccaagtctgcttccccggcaccgaggggcctcggccatcaac
tggaccctcattcatggagacaaaaaaggagggttcagcatcttctgggcggacgatggc
ctggacactggggaccttctgctccagaaggagtgtgaggtcctcccggacgacactgtg
agcagtctgtacaaccgcttcctcttccccgaaggcgtcaaagggatggtgcaagctgtg
aggctgatcgcggagggcagagcccccagactccctcagcctgaggagggagccacttat
gagggcattcagaagaaggaaacggccaagatcaactgggagcaaccagcagaggccatt
cataactggatccgtgggaatgacaaggtgccaggtgcctggacagaggcctgtgggcag
aagctgacgtttttcaactcgacactgaacactgtgggcctggtgcctgagggagaggcg
ctgcccatcccaggagcccatcggccggggctggtcaccaaagatggactcgtgctcttc
gggaacgatgacagaatgctgctggtgaagaacatccagctggaggatgggaagatgatc
ttggcctcgcacttcttcaagggagccgacagcagtgtcctcgaactgacagaggcagag
ctggtcaccgccgaggctgtgcggagtgcctggaaacggattctccccaacatcctggag
gtggaagactccactgacttcttcaagtcgggggctgcgtcggtggatgttgtgagattg
gtggaagaagtgaaggagctgtgcgatggcctggaattagaaaatgaagatgtttacatg
gcgaccaccttcagggacttcatccagctactagtgagaaagctgcgaggagatgacaaa
gagagcgagtgcgtcattgactatgtagaaaaggaagcgaacaggctgacaatcaagatg
ccccaccagctcttcattgggggcgcgtttgtggatgccgagggggacaagacttatgag
accatcaacccgacagatggaagtgccatctgccaggtgtcccttgcccaggtcagcgat
gttgacaaggcagtggctgctgcaaaggatgcttttgagaacggattgtgggggaagatt
agcgctcgcgaccggggccggctcctgtacaggttggcagacctcatggagcagcatcag
gaggagctggccaccatcgaggctctggacgcaggcgccgtctacacgctggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgctggctggtgcgacaagatc
caggtgggagctggctcctgctctccacgagagagctcacacaggcgggctggcctggtg
atgaactccaaaaaacctgtccaggtctgtggcattgtcatcccctggaactaccccctg
atgatgctctcctggaagacggctgcctgcctggctgctgggaacacagtggtgatcaag
cctgcccaggtgaccccactcacagccttgaagtttgcagagctgaccttgaaggccggc
attcccaagggcgtgatcaacatcctcccgggatctggctcgctggtcggccagagactc
tcagaccatcccgatgtgcggaaaattgggttcacaggctccacagaggtgggaaagcac
atcatgaagagctgtgccctgagtaatgtgaagaaggtctccctggagctgggcgggaag
tcacctctcatcatctttgctgactgcgacctcagcaaggcggtgcagatggggatgagc
tctgtcttcttcaacaaaggggagaactgcatcgccgcaggccggctctttgtggaggac
tcaattcatgaccagtttgtgcagaaggtggtagaagaggtgaggaagatgaagatcggc
aaccctctcgaccgggacaccacccatggaccgcagaaccaccaagctcacctgcggaag
ctgatagaatattgccagcgcggtgtgaaggaaggggccacgctcgtctgtggtgggaat
caagtccctcggccaggtttcttctttgagccaactgttttcacggacgtggaggaccac
atgttcatagccaaggaggagtccttcgggcccatcatgatcatctctcggtttgccaat
ggtgacgtggacactgtgctgtctcgggccaatgccacggagtttggcctggcctctggc
gtcttcaccaaggacatcaacaaggctctgtatgtcagtgacaagctgcaggcaggcacc
gtgtttgtcaatacatacaacaagaccgacgtggccgctccctttggagggttcaaacag
tccggatttggcaaagacctgggagaggccgccctgaatgagtacctgcgggtcaagaca
gttactttcgagtactga

DBGET integrated database retrieval system