KEGG   Equus caballus (horse): 100061213Help
Entry
100061213         CDS       T01058                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ecb  Equus caballus (horse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ecb00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 793 aa AA seqDB search
MLSQVYRSGFQPFGQRLLPWVQSPGLSRSHRVQPSAIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVIS
VKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSR
VGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPT
VEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPL
LKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFES
RPDCLPQVAALAIASGNGLLLKGGKEATHSNRILHLLTQEALSIHGVKEAVQLVNTREEV
EDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVR
DSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVK
SLRTEYGDLELCIEVVDNVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWN
ASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKY
LHETLPVPQRNTN
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtctaccgctctgggttccagcccttcggccagcgtctcctgccttgg
gtccaatctccaggtctctccagatcacatcgtgtgcagccttctgccattagacatgtt
cgttcttggagcaacatcccctttatcactgtacccctcagtcgtacacacggcaagtct
ttcgcgcaccgcagtgagctgaagcacgccaagaggatcgtggtgaaacttggaagtgct
gtggtgacccgaggggacgaatgtggcctggcactggggcgcctggcatccattgtcgag
caggtgtcagtgctgcagaatcaaggccgagagatgatgctggtgaccagtggagctgtg
gcctttgggaagcaacgcttgcgccatgagatccttctgtctcagagcgtgcggcaggcc
ctgcactcggggcagaaccagctgaaagagatggcaataccggtcttagaagcccgagcc
tgcgcagctgctggacagagtggcctgatggccttgtatgaagccatgtttacccagtac
agcatctgtgctgcccagattttggtgaccaatttggatttccacgatgagcagaagcgc
cggaaccttaatgggacacttcatgagctcctgcggatgaacatcgtccccattgtcaac
acaaatgatgctgttgtccccccagctgagcccaatagtgatctccagggggttattagt
gttaaagataatgatagcctggctgcccgtctggccgtggagatgaaaactgacctcttg
attgttctttcagatgtcgaaggcctgtttgacagccccccaggatcagatgatgcaaag
ctcattgatatattttatcctggagatcagcagtctgtgacgttcggaaccaagtcgaga
gtagggatgggtggcatggaagccaaggtgaaagcagccctctgggctttgcaaggtggc
acttctgtggttattgccaacggaacccacccaaaggtgtctgggcacgtcatcacagac
atcgtggaggggaagaaagttggcaccttcttttccgaagtaaagcctgcaggccctact
gttgagcagcagggagaaatggctcgatcaggagggcggatgttggccactttggaacct
gagcagagagcagaaattatccatcatctggctgatctgttgacagaccagcgtgacgag
atcctgttagccaacaaaaaagacttggaggaggcagaaggcagacttgcagcccctctg
ctgaaacggttgagcctctccacgtccaagttgaacagcctggccatcggtctgcggcag
attgcggcctcctcacaggacagcgtgggacgtgttttgcgccggacccgaattgccaaa
aacttggaactagaacaagtgactgtcccaattggagttctcctggtcatctttgaatct
cgccctgactgtctaccccaggtggcagccttggctattgcaagtggtaatggcttgtta
ctcaaaggagggaaggaggccacccacagcaaccggattctccacctcctaacccaggag
gccctctcgatccatggagtgaaggaggccgtacaactagtgaataccagagaagaagtg
gaagatctttgccgcctagacaaaatgatagatcttattattccacgtggctcttcccag
ctggtcagagacatccagaaagctgctaagggcattccagtgatggggcacagtgaaggg
atctgtcacatgtatgtggactcagaggccagtgtggataaagtcactagactagtcaga
gactcgaaatgtgagtatccagctgcctgtaatgctttagagactctgttgatccatcga
gatctgctgagaacaccattgtttgaccagatcattgatatgctgagagtggaacaggtg
aagattcacgcaggccccaagttcgcctcctatttgaccttcagcccctccgaagtgaag
tccctccgaactgagtatggggacctggaattgtgcattgaagtggtggacaacgtccag
gaggccatcgaccacatccacaagtacggcagctcccacacagatgtcatcgtcacagag
aatgagaaaacagcagagttcttcctccagcacgtggatagcgcctgcgtgttctggaac
gccagcactcgcttctctgatggctaccgcttcggactaggagctgaagtgggcatcagt
acatcacgaatccacgcccggggaccagtaggactggagggactccttaccaccaagtgg
ctgctgcgagggcaagaccacgtggtctcagatttctcagagcatggaagtttaaaatat
cttcacgagaccctccctgttcctcagagaaacaccaactga

DBGET integrated database retrieval system