KEGG   Equus caballus (horse): 100061295Help
Entry
100061295         CDS       T01058                                 

Gene name
PFN1
Definition
(RefSeq) profilin 1
  KO
K05759  
profilin
Organism
ecb  Equus caballus (horse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100061295 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100061295 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100061295 (PFN1)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100061295 (PFN1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100061295 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH
GGMINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc
gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag
gatggagaatttaccatggatcttcgtaccaagagcaccggcggagcccccaccttcaac
atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system