KEGG   Equus caballus (horse): 100061320Help
Entry
100061320         CDS       T01058                                 

Gene name
POM121C
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100061320 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 974 aa AA seqDB search
MVCSPVTVRIAPPDRKLTRSPRPEQMISSTLSSPSSNAPDPCAKETVLSALKEKKKRTVE
EEEDQIFTDSQENKRRRHDSSGSGHSAFEPLVANGGPASFVPKPGSLKRGLNSQSSDDHS
NKRSRTSSVSSLTSTYTGGIPSSSRNAITSSYSSTRGFSQLWKGSGPSSSPFSSPASSRS
QTPERPAKKIREEELSHHSSSSTPLVIDKESQGEKVADATAWKKQNSWNSPSTPGSSGQR
KRKIQLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKVLEDETDTASNSVTE
NPPTTQPSFPFTLPAAGTTSSPTSLPAPSANPLLESLKKMQSSPGLPSFPESAGVATTVA
HLPPKTPSLLASLGSSQSGPLPGTSSDSKSTVTFLGLTPASSTIPVTDTTKSPQAPQAET
SAKSQALSAPSPTPKQSILFGMLSTPSANPSASAAPAVSSASPMFKPIFVAPAISENEGS
LQASPSKVTTTTTSASALPMTTSTPPPTFKPIFSSMGPPTSVPLSTPFSFNQTTTPATTT
SAPLFIGQASAASTVASVTTASTSADSAPKPAFGFGVSNVTSTLSSMTSTTTSTSQSFLF
GTPPASGASFTPAVGSIFQFGKPSAMPTSTTVTTFGQSLPSAVQTAASSSTAGFSGFGNT
LTTSAPVTTSQPTLTFSSTTTPAFNIPFGSSTKPLPAYPGANAQPAFGATDGQQQGTTKP
ALAPSFGSSFTFGNSAAAALTATPAPAPAQPAFGSAGQSAFGGLKPAASAFGAPANTQPA
FGSTTAVFSFGAATTSGFGATTQTTSSGTSSSMFGSTTSSPFTFGGSAAPAGSAGFGINV
ATPGTSSTSGAFSFGGGQSGTTGSTTPFGAGLSQTTLGAPGQSTPFAFNVASTPESKPVF
GGTSTPTFGQNTPAPGVGTSGSSLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGA
RQRLQARRQHNRKK
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcagcccagtgacggtgaggatagctcctcccgaccgcaaactgactcgttct
ccaagaccagagcagatgatcagctcaacactgtcctcaccatcaagtaatgccccagac
ccatgtgcaaaggagactgtactgagtgccctcaaagagaagaagaaaaggacagtggaa
gaggaggaggaccaaatattcactgacagccaggaaaataaaagaaggcgccatgatagc
agtgggagtggacattcagcgtttgagcccctggtggccaatggaggccctgcttccttt
gtgcctaagcctgggtctctgaagagaggtctcaattcccagagctcagatgaccactcg
aataagagatcccgcacctcctctgtgagctccttgacaagcacgtacacgggtggcatc
cctagttccagccgcaatgccattaccagttcttacagctcgactcgaggtttctctcag
ctgtggaagggaagtggtcccagttcatcacccttctcaagcccagcctcatcccgatcc
cagactccagagaggccagcaaagaaaataagagaagaggagctttctcatcattctagt
tcttcaactccattggtaatagacaaggagtcccagggagaaaaggttgcagatgcaact
gcatggaagaaacaaaactcgtggaattccccatctacacctggcagctctgggcaacgt
aaacggaagattcagctgctgccctccaggcgaggggaccagctgaccttgcctccacct
ccccagcttggttattcaattactgctgaagacctagacttggaaaagaaagcttcgtta
caatggtttaacaaggtcttggaggacgagactgacactgcctcaaactctgtcactgag
aacccacccaccactcagccttcttttccttttaccctgcctgctgctgggactacttcc
tccccaacctccctcccagccccaagtgctaacccgctgttggagagcttgaaaaagatg
cagagttccccgggcttaccatccttcccagaatctgctggagtggcaaccactgtggcc
catttgcctccgaagacacccagccttctggcctctcttgggtcttcacagtcagggccc
cttccaggcacctcttcagactccaagtccacggtcactttcttggggctgacccctgct
tcttccacgataccagtcactgacaccaccaagtcacctcaagcccctcaagccgagaca
tctgccaaatcccaagccctgtctgccccatcccccacccccaagcaaagtattctcttt
ggaatgctgagcaccccctctgctaacccttctgcctctgcagctcctgctgtgtcttca
gcatctcccatgttcaagcccatttttgtggccccagctataagtgagaatgagggctcc
ttgcaggctagcccttccaaggttaccaccaccacaacttccgcgtctgccctccccatg
actaccagcacccctcccccgacttttaagcctatctttagcagcatgggtccacctaca
tctgtgcccttatcaactcccttctccttcaatcagacaactactccagccactaccacg
agcgcccctctattcattggtcaggccagtgccgcttcaacagtggcttctgtgactaca
gccagcacatccgcagactctgctccaaagcctgcatttggctttggtgtgagcaatgtg
accagcaccctgagtagcatgactagcaccaccacttccacttcacagtctttcctcttc
gggactccccctgcctctggggccagctttaccccagccgtgggctccatattccaattt
ggcaagccttctgccatgcctacttctacgacagtcaccacctttggccagtccctaccc
agtgccgttcagacagccgccagcagcagcactgccggctttagtggttttggtaacacc
cttaccacctcagccccagtcaccaccagccagccgacgctgacattcagtagcactacc
accccagcatttaacattccctttggctcaagcaccaagcctctcccagcatatccagga
gccaatgcccagccagcgtttggggccactgatgggcagcagcaggggactaccaagcca
gctcttgcccccagctttggcagctctttcacttttggaaactctgcagccgcagccctg
actgcaactccagcaccagcccctgcccagccagccttcggcagtgctgggcagtcggct
tttggtggtttgaaacccgcagcctctgcctttggtgcccctgccaacactcagccagcc
tttggcagcaccacggctgttttctcctttggtgcagccaccacctctggctttggagct
acaacccagaccaccagcagcgggaccagtagctcaatgtttggcagcacaacgtcatca
cccttcacatttgggggatcagcagccccagctggcagtgcgggctttgggatcaatgtg
gctaccccaggcaccagttcaacctctggagctttcagctttggaggaggacagagcggg
accactggcagcacaaccccctttggggcaggcttgagtcagaccacgttgggcgcaccc
ggccagagcacaccctttgccttcaatgtggccagcacacctgagagcaaacctgtgttt
ggaggcacctccacacccacctttggtcagaacacccctgcccctggggtgggcacgtcg
ggcagcagcctctcctttggagcatcctcaacacccacccagggctttgttggagtcgga
cctttcggctcggctgccccttcgttttccattggtgccggatccaagaccccaggggct
cggcagcgcctgcaggcccgaaggcagcacaaccgcaagaagtag

DBGET integrated database retrieval system