KEGG   Equus caballus (horse): 100061405Help
Entry
100061405         CDS       T01058                                 

Gene name
HDAC3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100061405 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100061405 (HDAC3)
  Substance dependence
   05034 Alcoholism
    100061405 (HDAC3)
  Infectious diseases
   05165 Human papillomavirus infection
    100061405 (HDAC3)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100061405 (HDAC3)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100061405 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
14
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
SQVVEFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggggcc
gggcaccctatgaagccccatcgcttggcattgacccatagtctggtcctgcactacggt
ctctataagaagatgatcgtcttcaagccataccaggcatcccagcatgacatgtgccgc
ttccactctgaagactacatcgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaatgtgggcgatgactgtccagtgtttcccgggctc
tttgagttctgctctcgttatacaggcgcatctctgcaaggagcaacccagttgaacaac
aagatctgtgatattgccatcaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcctggagctcctcaagtac
caccctcgggtgctctacattgatattgacatccaccatggtgacggggttcaggaagcc
ttctacctcactgaccgggtcatgaccgtgtccttccacaaatacggaaactatttcttc
cctggcacaggtgacatgtatgaagttggagcagagagtggccgctactactgtctcaat
gtgccgctgcgggatggcattgatgaccagagttacaagcaccttttccagccagttatc
agccaggtggtggaattctaccaacccacgtgcattgtgctccagtgtggagctgactca
ctgggctgtgatcgattgggctgcttcaacctcagtattcgaggacatggggagtgtgtc
gaatacgtcaagagcttcaatattcctctactggtgctaggtggtggtggctatactgtc
cgaaatgttgcccgctgctggacgtatgagacatcgttgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccggacttcacgctccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcgcctagcgtccagattcatgatgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcca
gaggagaactacagcaggccagaggcacccaatgaattctatgatggagaccatgacaac
gacaaggaaagcgacgtggagatttaa

DBGET integrated database retrieval system