KEGG   Equus caballus (horse): 100061405Help
Entry
100061405         CDS       T01058                                 

Gene name
HDAC3
Definition
histone deacetylase 3
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ecb04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
SQVVEFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggggcc
gggcaccctatgaagccccatcgcttggcattgacccatagtctggtcctgcactacggt
ctctataagaagatgatcgtcttcaagccataccaggcatcccagcatgacatgtgccgc
ttccactctgaagactacatcgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaatgtgggcgatgactgtccagtgtttcccgggctc
tttgagttctgctctcgttatacaggcgcatctctgcaaggagcaacccagttgaacaac
aagatctgtgatattgccatcaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcctggagctcctcaagtac
caccctcgggtgctctacattgatattgacatccaccatggtgacggggttcaggaagcc
ttctacctcactgaccgggtcatgaccgtgtccttccacaaatacggaaactatttcttc
cctggcacaggtgacatgtatgaagttggagcagagagtggccgctactactgtctcaat
gtgccgctgcgggatggcattgatgaccagagttacaagcaccttttccagccagttatc
agccaggtggtggaattctaccaacccacgtgcattgtgctccagtgtggagctgactca
ctgggctgtgatcgattgggctgcttcaacctcagtattcgaggacatggggagtgtgtc
gaatacgtcaagagcttcaatattcctctactggtgctaggtggtggtggctatactgtc
cgaaatgttgcccgctgctggacgtatgagacatcgttgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccggacttcacgctccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcgcctagcgtccagattcatgatgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcca
gaggagaactacagcaggccagaggcacccaatgaattctatgatggagaccatgacaac
gacaaggaaagcgacgtggagatttaa

DBGET integrated database retrieval system