KEGG   Equus caballus (horse): 100061520Help
Entry
100061520         CDS       T01058                                 

Gene name
CES5A
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100061520 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 525 aa AA seqDB search
MSGEWVYPGKTLIWIVGVLAAATEGPAADAPVRSTRLGWIRGKQATVLGSAMPVNVFLGV
PYAAPPLGPLRFAKPKPALPWNDFRDATSYPKLCLQNTEWLLLDQHILRVRYPKFHVSED
CLYLNIYAPAHADTGSKLPVMVWFPGGAFESGSASLFDGSALAAYEDVLVVTTQYRLGML
GFFNTGNQHALGNWAFMDQMAALHWVQENIEFFGGDPRSVTIFGESAGAISVSSLILSPM
ANGLFHKAIMESGVAVIPYLKASDDERNEALQVVADICGCNSSDSVALLQCLRAKPSEEL
LIISQKTKAFTRVVDGFVFPEEPVDLLTKKTFNPIPSIIGVNNHECGFLLPMKEFPEILG
DSNKSLALRLIHTILHVPVQHLHLVANEYFYNKHSLFEIRNSFLDLLGDVFFVVPALVTA
QYHREGATEEERLLSRKMMRYWANFARTGDPNGEGLPLWPVYNKTEWYLQLDLNVSLGQS
LKELEVEFWTETLPLIMSTSGALLSPLSSLVLLSLLLPAFFYFAP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggagtgggtgtacccaggcaagaccctgatctggattgttggggtccttgca
gctgccaccgaggggccagctgcagatgcaccagtgaggagcaccaggctgggatggatc
cgagggaagcaagccactgtgcttggaagtgccatgcctgtgaatgtgttcctcggggtc
ccctatgctgcaccccctttaggacccctgagatttgcgaaaccgaagcctgcgttaccc
tggaatgacttccgagatgccacatcctatcctaaattgtgcctccagaacacagagtgg
ctgctcttggatcaacacattctcagggtgcgttaccccaaattccacgtgtcggaagac
tgcctgtacctcaacatctacgcgccggcccacgcggacacgggctccaagctccctgtc
atggtgtggttccctgggggtgccttcgagagtggctcagcctccctcttcgatgggtct
gccctggctgcctacgaggacgtgctggttgtgaccacccagtaccggctaggaatgctt
ggcttcttcaacacagggaaccagcacgcactggggaactgggccttcatggaccagatg
gccgcgctgcactgggtccaggagaatatcgaattctttggtggggacccacgctctgtg
accatctttggggagtcagcaggagccataagcgtgtccagccttattctgtcccccatg
gccaatggcttattccacaaagccatcatggagagtggggtggccgtcatcccttacctg
aaggcctctgatgatgagaggaatgaggctttgcaggtggttgcggatatctgtggttgc
aattcatcagactccgtggccctgcttcagtgtctgagggcaaaaccctctgaggagttg
ctgatcatcagccagaaaaccaaggctttcactcgagtggttgatggttttgtctttcct
gaagagcctgtagacctattgactaaaaaaacatttaatccaatcccttctatcatcggc
gtcaataaccacgagtgtggcttcctgctgcccatgaaggagtttcctgagatccttggg
gactccaacaagtctctcgccctgcgcttgatacacacaatcctgcatgtccctgtccag
catttacaccttgtggctaatgaatacttctacaacaagcactccctgtttgaaatacga
aatagttttctggacctgcttggagatgtattttttgtggtccctgcgctggtcacagct
caatatcacagagaaggagccacagaggaggagagattgctgagcaggaagatgatgcga
tactgggctaactttgctcgcactggggatcctaacggggaaggcctgcctctgtggccg
gtctacaataagaccgagtggtacctgcagctggacctgaatgtgagcctgggacagagt
ctgaaggagctggaggtggagttttggacggaaaccctccccctgataatgtccacttcc
ggggcgctcctcagtcctctctcctccttagtcttgctgtctctgctcctgcctgccttt
ttctattttgctccttaa

DBGET integrated database retrieval system