KEGG   Equus caballus (horse): 100061561Help
Entry
100061561         CDS       T01058                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA 4
  KO
K05200  
glutamate receptor 4
Organism
ecb  Equus caballus (horse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100061561 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100061561 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100061561 (GRIA4)
   04728 Dopaminergic synapse
    100061561 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100061561 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100061561 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100061561 (GRIA4)
   05033 Nicotine addiction
    100061561 (GRIA4)
Ion channels [BR:ecb04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100061561 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 778 aa AA seqDB search
MEVEPHDPGPPAIAQSLVAAEWRSTHNSDIPTTAALAATKKQARTEVVPQKPSSVSTLPL
PTTLPMVAELLTQVSLDAAEGSAIPVPQVAKPATTVTLTTIVSVGKHVKGYHYIIANLGF
KDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDG
VLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFD
HYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIME
SPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNG
MVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLA
YEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLG
AFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQ
TEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAF
LLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKL
KNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEA
KRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggagccacatgatcctgggcccccagccatagctcagagcctggtagcagca
gagtggaggagcacacacaactcagacatcccaactacagcagcacttgcagccacaaag
aaacaggcaagaacagaggtggtgccccagaaacccagctctgtgtctacccttcctctc
cccaccactcttccaatggtggcagaacttctgacccaggtgagcctggatgcagcagag
gggtcagccatccctgtaccacaagtggcaaaaccagcaaccacagtgacactgacaaca
attgtgagtgttggaaagcatgttaaaggctaccattatatcattgcaaacttgggattc
aaggatatttctcttgagaggtttatccatggtggagccaatgttacaggatttcagttg
gtagattttaatacacctatggtaaccaaactaatggatcgttggaagaaactagatcag
agggagtatccaggatctgagactcctccaaagtacacgtctgctctgacttatgatgga
gtcctcgtgatggccgaaactttccgaaatcttagaaggcagaaaattgatatttcgagg
agaggcaatgccggagattgtctggcaaatcctgctgctccatggggccagggaattgac
atggagaggacactcaaacaggttcgaattcaagggctgacagggaatgttcagtttgac
cactatggacgtagggtcaattacacaatggatgtgtttgagctgaagagcacaggacct
agaaaggttggttactggaatgatatggataagttagtcttaattcaagatgtccccact
cttggcaatgacactgcagctattgagaacagaacagtggttgtaaccacaattatggaa
tccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaatgacaagtatgaa
ggatactgtgtagatttggcatctgaaattgcaaaacatattggtatcaagtataaaatt
gccattgtccctgatggaaaatatggagcaagggatgcagacacaaaaatctggaatggg
atggtaggagaacttgtttatgggaaagcagagattgctattgcccctctgacaatcact
ttggtacgagaggaggtcattgacttctctaagcccttcatgagtttgggcatatctatc
atgatcaaaaagcctcagaaatctaaaccaggagtgttttccttcttggatcctctggcc
tatgagatttggatgtgcatagtctttgcctacattggcgtcagcgtggtcttgttccta
gttagtaggtttagtccgtatgagtggcacacagaagagccagaggatggaaaggaagga
cccagcgaccagcctcccaatgagtttggcatctttaacagcctctggttttccctgggt
gcttttatgcaacaaggatgtgacatttcacccagatccctctcaggtcgaattgttgga
ggtgtttggtggttctttaccctcatcattatatcatcttatactgctaacctcgctgct
ttcctgacggttgagcgaatggtctcccccatagaaagtgcggaagacttggccaaacaa
acagaaattgcctatggaacactggattcagggtcaacaaaagaattcttcagaagatca
aaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagagccgtcagtgttc
actaggactacagctgagggagtagctcgtgtccgcaaatccaagggcaaatttgccttt
ctcctggagtccactatgaatgaatacattgagcagcgaaagccgtgtgacacgatgaaa
gtgggaggaaatctggattcgaaaggctatggagtagcaacgcccaagggttcctcatta
agaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctcttggacaaattg
aaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggtgactccaaggac
aagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacattctggttggcggc
ttgggcttggcaatgctggtggctttgatagagttctgttacaagtccagggcagaagcg
aagagaatgaagctgaccttttctgaagccataagaaacaaagccagattatccatcact
gggagtgtgggtgagaatggccgcgtcttgacgcctgactgcccaaaggctgtacacact
ggaactgcaattagacaaagttcaggattggctgtcattgcatcggacctaccataa

DBGET integrated database retrieval system