KEGG   Equus caballus (horse): 100061578Help
Entry
100061578         CDS       T01058                                 

Definition
(RefSeq) sperm acrosome-associated protein 5
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100061578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
X
AA seq 164 aa AA seqDB search
MQAWGMAVVTLAMLMVAAVDAKIYERCDLAMKLEKAGLNGFRGYSIGDWLCMAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCDNGVTPTQNLCHMECHDLLNRHILDDVLCAKQVVS
SQNGMNAWDSWTRHCAGHDLSEWLKGCNLYVKPNAKKVNSGSQR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctggggcatggcggtggtgaccctggccatgttgatggttgccgctgtggat
gccaagatctatgaacgctgcgacctggcaatgaagctggagaaggcgggcctcaacggc
ttcaggggctacagcattggagactggctgtgcatggcacactatgagagtggctttgat
acctccttcgtggaccacaatcctgatggcagcagtgaatatggtattttccagctgaac
tctgcctggtggtgtgacaatggtgttacacccacccagaacctctgtcacatggagtgt
catgacttgctcaaccgccatattctggatgatgtcttgtgtgccaagcaggtggtatcc
tcacagaatggtatgaatgcctgggattcttggacccgtcactgtgctggccacgattta
tctgaatggctcaaggggtgtaatctgtatgtaaaacctaatgcaaagaaagttaattcg
ggttcccagagatag

DBGET integrated database retrieval system