KEGG   Equus caballus (horse): 100061609Help
Entry
100061609         CDS       T01058                                 

Definition
cytochrome P450 2C26-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100061609
   00590 Arachidonic acid metabolism
    100061609
   00591 Linoleic acid metabolism
    100061609
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100061609
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100061609
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100061609
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100061609
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100061609
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100061609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 490 aa AA seqDB search
MDLVVFLGLCLSCWFLLSLWKQSSRKGKLPPGPTPLPIIGNILQLDVKDISKSLSNLSKL
YGPVFTLYLGLKPTVVLHGYEAVKEALIDLGEEFSGRGSFPVAERVNKGHGILFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
IIFQNRFDYTDQTFLNLLEKFNENLRIMSSPWIQVCNNLPALIDYLPGSHNKMLKNFDYL
KSYVLEKTKEHQESLDIDNPRDFIDCFLIKMEQEKHNQQSEFTFENLIAAVSDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIDRVIGRHRSPSMQDRSHMPYMDAVIHEIQRYTD
IVPTNLPHAVTCDVKFRNYIIPKGTTILTSLTSVLYDAKEFHNPEVFDPGHFLDESGNFK
KSDYFMAFSAGKRMCLGEGLARMELFLFLTTILQKFTLKSVVDPKDIDTTPAASGFGHVP
ASYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatctggttgtgttcctggggctctgtctctcctgttggtttctcctttcactctgg
aaacagagctccaggaaagggaagctcccacctggccccactcctctccctattattgga
aatatcctacagttagatgttaaggacatcagcaaatccttaagcaatctctcaaaactc
tatggccctgtgttcactctgtatttgggcttgaagcccactgtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatctgggagaggagttttctggaagaggcagtttc
ccagtggctgaaagagttaataaaggacatggaatccttttcagcaatggaaagaggtgg
aaggagatccgtcgtttctccctcatgactctgcggaactttgggatggggaagaggagc
attgaggaccgagttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaat
gcttcaccctgtgaccccacttttatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccagaatcgttttgattatacagatcagacttttcttaacttgctggaaaaa
tttaatgaaaacctcaggattatgagctctccatggatacaggtctgcaataatctccct
gctctcattgattatctcccagggagtcataacaaaatgcttaaaaattttgattatttg
aaaagttacgttttggagaaaacaaaagaacaccaagaatccctggacattgacaatcct
cgggacttcattgattgtttcctgatcaaaatggaacaggaaaagcacaatcaacagtcg
gagtttacttttgaaaacttgatagctgctgtatccgatttgtttggagctgggacagag
acaacgagcaccaccctaagatatgctctcctgctcttgctgaagcatccagaggtcaca
gctaaagttcaggaagaaattgaccgtgtgattggtagacaccggagccccagcatgcag
gacaggagccacatgccctacatggatgccgtgatacacgagattcagagatacactgac
atcgtccccaccaacctgcctcatgcagtgacctgtgacgttaaatttagaaactatatc
atccccaagggcacgaccatattaacatcactgacttccgtgctgtacgatgctaaagaa
ttccacaacccagaggtgtttgatcctggccacttcctggatgagagtggcaactttaag
aagagcgactacttcatggctttctcagcaggaaaacgaatgtgtctgggagaaggtcta
gcccgcatggagctgtttttatttctgaccaccattttacagaaatttaccctaaaatct
gtggttgacccaaaggatatcgacaccaccccagctgccagtgggtttggccatgtgcca
gcctcataccagctctgctttattcctgtgtga

DBGET integrated database retrieval system